KEGG   Homo sapiens (human): 254531
Entry
254531            CDS       T01001                                 

Gene name
LPCAT4, AGPAT7, AYTL3, LPAAT-eta, LPEAT2
Definition
(RefSeq) lysophosphatidylcholine acyltransferase 4
  KO
K13512  lysophospholipid acyltransferase [EC:2.3.1.23 2.3.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    254531 (LPCAT4)
   00565 Ether lipid metabolism
    254531 (LPCAT4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    254531 (LPCAT4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.23  1-acylglycerophosphocholine O-acyltransferase
     254531 (LPCAT4)
    2.3.1.-  
     254531 (LPCAT4)
Lipid biosynthesis proteins [BR:hsa01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   254531 (LPCAT4)
SSDB
Motif
Pfam: Acyltransferase
Other DBs
NCBI-GeneID: 254531
NCBI-ProteinID: NP_705841
OMIM: 612039
HGNC: 30059
Ensembl: ENSG00000176454
Vega: OTTHUMG00000172349
Pharos: Q643R3(Tdark)
UniProt: Q643R3
Position
15q14
AA seq 524 aa
MSQGSPGDWAPLDPTPGPPASPNPFVHELHLSRLQRVKFCLLGALLAPIRVLLAFIVLFL
LWPFAWLQVAGLSEEQLQEPITGWRKTVCHNGVLGLSRLLFFLLGFLRIRVRGQRASRLQ
APVLVAAPHSTFFDPIVLLPCDLPKVVSRAENLSVPVIGALLRFNQAILVSRHDPASRRR
VVEEVRRRATSGGKWPQVLFFPEGTCSNKKALLKFKPGAFIAGVPVQPVLIRYPNSLDTT
SWAWRGPGVLKVLWLTASQPCSIVDVEFLPVYHPSPEESRDPTLYANNVQRVMAQALGIP
ATECEFVGSLPVIVVGRLKVALEPQLWELGKVLRKAGLSAGYVDAGAEPGRSRMISQEEF
ARQLQLSDPQTVAGAFGYFQQDTKGLVDFRDVALALAALDGGRSLEELTRLAFELFAEEQ
AEGPNRLLYKDGFSTILHLLLGSPHPAATALHAELCQAGSSQGLSLCQFQNFSLHDPLYG
KLFSTYLRPPHTSRGTSQTPNASSPGNPTALANGTVQAPKQKGD
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgagccagggaagtccgggggactgggcccccctagatcccacccccggacccccagca
tcccccaaccccttcgtgcatgagttacatctctctcgcctccagagggttaagttctgc
ctcctgggggcattgctggcccccatccgagtgcttctggcctttatcgtcctctttctc
ctctggccctttgcctggcttcaagtggccggtcttagtgaggagcagcttcaggagcca
attacaggatggaggaagactgtgtgccacaacggggtgctaggcctgagccgcctgctg
tttttcctgctgggcttcctccggattcgcgttcgtggccagcgagcctctcgccttcaa
gcccctgtccttgttgctgccccacactccactttctttgaccccattgttctgctgccc
tgtgacctgcccaaagttgtgtcccgagctgagaacctttccgttcctgtcattggagcc
cttcttcgattcaaccaagccatcctggtatcccggcatgacccggcttctcgacgcaga
gtggtggaggaggtccgaaggcgggccacctcaggaggcaagtggccgcaggtgctattc
tttcctgagggcacctgttccaacaagaaggctttgcttaagttcaaaccaggagccttc
atcgcaggggtgcctgtgcagcctgtcctcatccgctaccccaacagtctggacaccacc
agctgggcatggaggggtcctggagtactcaaagtcctctggctcacagcctctcagccc
tgcagcattgtggatgtggagttccttcctgtgtatcaccccagccctgaggagagcagg
gaccccaccctctatgccaacaatgttcagagggtcatggcacaggctctgggcattcca
gccaccgaatgtgagtttgtagggagcttacctgtgattgtggtgggccggctgaaggtg
gcgttggaaccacagctctgggaactgggaaaagtgcttcggaaggctgggctgtccgct
ggctatgtggacgctggggcagagccaggccggagtcgaatgatcagccaggaagagttt
gccaggcagctacagctctctgatcctcagacggtggctggtgcctttggctacttccag
caggataccaagggtttggtggacttccgagatgtggcccttgcactagcagctctggat
gggggcaggagcctggaagagctaactcgtctggcctttgagctctttgctgaagagcaa
gcagagggtcccaaccgcctgctgtacaaagacggcttcagcaccatcctgcacctgctg
ctgggttcaccccaccctgctgccacagctttgcatgctgagctgtgccaggcaggatcc
agccaaggcctctccctctgtcagttccagaacttctccctccatgacccactctatggg
aaactcttcagcacctacctgcgccccccacacacctctcgaggcacctcccagacacca
aatgcctcatccccaggcaaccccactgctctggccaatgggactgtgcaagcacccaag
cagaagggagactga

KEGG   Homo sapiens (human): 54947
Entry
54947             CDS       T01001                                 

Gene name
LPCAT2, AGPAT11, AYTL1, LysoPAFAT
Definition
(RefSeq) lysophosphatidylcholine acyltransferase 2
  KO
K13510  lysophosphatidylcholine acyltransferase / lyso-PAF acetyltransferase [EC:2.3.1.23 2.3.1.67]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    54947 (LPCAT2)
   00565 Ether lipid metabolism
    54947 (LPCAT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    54947 (LPCAT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.23  1-acylglycerophosphocholine O-acyltransferase
     54947 (LPCAT2)
    2.3.1.67  1-alkylglycerophosphocholine O-acetyltransferase
     54947 (LPCAT2)
Lipid biosynthesis proteins [BR:hsa01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   54947 (LPCAT2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 Acyltransferase EF-hand_5 EF-hand_8 EF-hand_4 IF2_N
Other DBs
NCBI-GeneID: 54947
NCBI-ProteinID: NP_060309
OMIM: 612040
HGNC: 26032
Ensembl: ENSG00000087253
Vega: OTTHUMG00000133238
Pharos: Q7L5N7(Tbio)
UniProt: Q7L5N7
Position
16q12.2
AA seq 544 aa
MSRCAQAAEVAATVPGAGVGNVGLRPPMVPRQASFFPPPVPNPFVQQTQIGSARRVQIVL
LGIILLPIRVLLVALILLLAWPFAAISTVCCPEKLTHPITGWRRKITQTALKFLGRAMFF
SMGFIVAVKGKIASPLEAPVFVAAPHSTFFDGIACVVAGLPSMVSRNENAQVPLIGRLLR
AVQPVLVSRVDPDSRKNTINEIIKRTTSGGEWPQILVFPEGTCTNRSCLITFKPGAFIPG
VPVQPVLLRYPNKLDTVTWTWQGYTFIQLCMLTFCQLFTKVEVEFMPVQVPNDEEKNDPV
LFANKVRNLMAEALGIPVTDHTYEDCRLMISAGQLTLPMEAGLVEFTKISRKLKLDWDGV
RKHLDEYASIASSSKGGRIGIEEFAKYLKLPVSDVLRQLFALFDRNHDGSIDFREYVIGL
AVLCNPSNTEEIIQVAFKLFDVDEDGYITEEEFSTILQASLGVPDLDVSGLFKEIAQGDS
ISYEEFKSFALKHPEYAKIFTTYLDLQTCHVFSLPKEVQTTPSTASNKVSPEKHEESTSD
KKDD
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgagccggtgcgcccaggcggcggaagtggcggccacagtgccaggtgccggcgtcggg
aacgtggggctgcggccgcccatggtgccccgtcaggcgtccttcttcccgccgccggtg
ccgaaccccttcgtgcagcagacgcagatcggctccgcgaggcgggtccagattgtcctt
cttgggattatcttgcttccaattcgtgtcttattggttgcgttaattttattacttgca
tggccatttgctgcaatttcaacagtatgctgtcctgaaaagctgacccacccaataact
ggttggaggaggaaaattactcaaacagctttgaaatttctgggtcgtgctatgttcttt
tcaatgggatttatagttgctgtaaaaggaaagattgcaagtcctttggaagcaccagtt
tttgttgctgcccctcattcaacattctttgatggaattgcctgtgttgtagctgggtta
ccttctatggtatctcgaaatgagaatgcacaagtccctctgattggcagactgttacgg
gctgtgcaaccagttttggtgtcccgtgtagatccggattcccgaaaaaacacaataaat
gaaataataaagcgaacaacatcaggaggagaatggccccagatactagttttcccagaa
ggtacttgtactaatcgttcctgtttgattacttttaaaccaggagccttcattccagga
gttccagtgcagccagtcctcctcagatacccaaacaagctggatactgtgacctggaca
tggcaaggatatacattcattcagctttgtatgcttactttctgccagctcttcacaaag
gtagaagttgagtttatgccagttcaagtaccaaatgatgaagaaaaaaatgatcctgtc
ctttttgccaataaagtccggaatttaatggcagaagctctgggaataccagtaacagat
catacctatgaagactgcagattgatgatttcagcaggacagctaacattgcctatggaa
gctgggctggtggaatttactaaaattagccgaaaattgaaattagattgggatggtgtt
cgtaagcatttggatgaatatgcatctattgcgagttcctcaaaaggaggaagaattgga
attgaagaattcgccaagtatttaaagttgcctgtttcagatgtcttgagacaacttttt
gcactctttgacaggaaccatgatggcagcattgacttccgagagtatgtgattggcctg
gctgtcttgtgcaacccttccaacacagaggagatcatccaggtggcatttaagctgttt
gacgttgatgaggatggctacataacggaggaagagttctccaccattctacaggcttcc
cttggagtgcctgaccttgatgtttctggtctcttcaaggaaatagcccaaggggactca
atttcctatgaggaatttaaaagttttgccttaaagcatccagaatatgctaagatattt
acaacatacctagacctccagacgtgccatgtgttttcattaccaaaagaagtccagaca
accccctccaccgccagtaataaagtcagccctgaaaagcatgaagagagtacctcagac
aaaaaagatgactga

KEGG   Homo sapiens (human): 79888
Entry
79888             CDS       T01001                                 

Gene name
LPCAT1, AGPAT10, AGPAT9, AYTL2, LPCAT-1, PFAAP3, lpcat, lysoPAFAT
Definition
(RefSeq) lysophosphatidylcholine acyltransferase 1
  KO
K13510  lysophosphatidylcholine acyltransferase / lyso-PAF acetyltransferase [EC:2.3.1.23 2.3.1.67]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    79888 (LPCAT1)
   00565 Ether lipid metabolism
    79888 (LPCAT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    79888 (LPCAT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.23  1-acylglycerophosphocholine O-acyltransferase
     79888 (LPCAT1)
    2.3.1.67  1-alkylglycerophosphocholine O-acetyltransferase
     79888 (LPCAT1)
Lipid biosynthesis proteins [BR:hsa01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   79888 (LPCAT1)
SSDB
Motif
Pfam: Acyltransferase EF-hand_8 EF-hand_1 EF-hand_6 EF-hand_7 IF2_N
Other DBs
NCBI-GeneID: 79888
NCBI-ProteinID: NP_079106
OMIM: 610472
HGNC: 25718
Ensembl: ENSG00000153395
Vega: OTTHUMG00000131017
Pharos: Q8NF37(Tbio)
UniProt: Q8NF37
Position
5p15.33
AA seq 534 aa
MRLRGCGPRAAPASSAGASDARLLAPPGRNPFVHELRLSALQKAQVALMTLTLFPVRLLV
AAAMMLLAWPLALVASLGSAEKEPEQPPALWRKVVDFLLKAIMRTMWFAGGFHRVAVKGR
QALPTEAAILTLAPHSSYFDAIPVTMTMSSIVMKAESRDIPIWGTLIQYIRPVFVSRSDQ
DSRRKTVEEIKRRAQSNGKWPQIMIFPEGTCTNRTCLITFKPGAFIPGAPVQPVVLRYPN
KLDTITWTWQGPGALEILWLTLCQFHNQVEIEFLPVYSPSEEEKRNPALYASNVRRVMAE
ALGVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERAR
MKGGEKIGIAEFAASLEVPVSDLLEDMFSLFDESGSGEVDLRECVVALSVVCRPARTLDT
IQLAFKMYGAQEDGSVGEGDLSCILKTALGVAELTVTDLFRAIDQEEKGKITFADFHRFA
EMYPAFAEEYLYPDQTHFESCAETSPAPIPNGFCADFSPENSDAGRKPVRKKLD
NT seq 1605 nt   +upstreamnt  +downstreamnt
atgaggctgcggggatgcggaccccgggccgcccctgcctccagcgcaggggccagcgac
gctcggctgctggcgcccccggggcggaaccccttcgtgcacgagctgcgcctcagcgcc
ctgcagaaggcccaggtggccctcatgacactgacgctcttcccggtccggctcctggtt
gccgctgccatgatgctgctggcctggcccctcgcacttgtcgcatccctgggctctgcg
gagaaggaacccgagcagcccccggccctgtggaggaaggttgtggacttcctgctgaag
gccatcatgcgcaccatgtggttcgccggcggcttccaccgggtggccgtgaaggggcgg
caggcgctgcccaccgaggcggccatcctcacgctcgcgcctcactcgtcctacttcgac
gccatccctgtgaccatgacgatgtcctccatcgtgatgaaggcagagagcagagacatc
ccgatctggggaactctgatccagtatatacggcctgtgttcgtgtcccggtcagaccag
gattctcgcaggaaaacagtagaagaaatcaagagacgggcgcagtccaacggaaagtgg
ccacagataatgatttttccagaaggaacttgtacaaacaggacctgcctaattaccttc
aaacctggtgcattcatccctggagcgcccgtccagcctgtggttttacgatatccaaat
aaactggacaccatcacatggacgtggcaaggacctggagcgctggaaatcctgtggctc
acgctgtgtcagtttcacaaccaagtggaaatcgagttccttcctgtgtacagcccttct
gaggaggagaagaggaaccccgcgctgtatgccagcaacgtgcggcgagtcatggccgag
gccttgggtgtctccgtgactgactacacgttcgaggactgccagctggccctggcggaa
ggacagctccgtctccccgctgacacttgccttttagaatttgccaggctcgtgcggggc
ctcgggctaaaaccagaaaagcttgaaaaagatctggacagatactcagaaagagccagg
atgaagggaggagagaagataggtattgcggagtttgccgcctccctggaagtccccgtt
tctgacttgctggaagacatgttttcactgttcgacgagagcggcagcggcgaggtggac
ctgcgagagtgtgtggttgccctgtctgtcgtctgccggccggcccggaccctggacacc
atccagctggctttcaagatgtacggagcgcaagaggacggcagcgtcggcgaaggtgac
ctgtcctgcatcctcaagacggccctgggggtggcagagctcaccgtgaccgacctattc
cgagccattgaccaagaggagaaggggaagatcacattcgctgacttccacaggtttgca
gaaatgtaccctgccttcgcagaggaatacctgtacccggatcagacacatttcgaaagc
tgtgcagagacctcacctgcgccaatcccaaacggcttctgtgccgatttcagcccggaa
aactcagacgctgggcggaagcctgttcgcaagaagctggattag

DBGET integrated database retrieval system