KEGG   Homo sapiens (human): 254786Help
Entry
254786            CDS       T01001                                 

Gene name
OR6C3, OST709
Definition
(RefSeq) olfactory receptor family 6 subfamily C member 3
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    254786 (OR6C3)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    254786 (OR6C3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 254786
NCBI-ProteinID: NP_473445
HGNC: 15437
Ensembl: ENSG00000205329
Vega: OTTHUMG00000169861
Pharos: Q9NZP0(Tdark)
UniProt: Q9NZP0 A0A126GW44
Position
12q13.2
AA seq 311 aa AA seqDB search
MNHTMVTEFVLLGLSDDPDLQIVIFLFLFITYILSVTGNLTIITLTFVDSHLQTPMYFFL
RNFSFLEISFTTVCIPRFLGAIITRNKTISYNNCAAQLFFFIFMGVTEFYILTAMSYDRY
VAICKPLHYTSIMNRKLCTLLVLCAWLSGFLTIFPPLMLLLQLDYCASNVIDHFACDYFP
LLQLSCSDTWLLEVIGFYFALVTLLFTLALVILSYMYIIRTILRIPSASQRKKAFSTCSS
HMIVISISYGSCIFMYANPSAKEKASLTKGIAILNTSVAPMLNPFIYTLRNQQVKQAFKN
VVHKVVFYANQ
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacacaatggtcacagagtttgtcctcctgggcctttctgatgatcctgacctt
cagattgtgatttttctctttttatttatcacgtatatattaagtgttactggaaacctg
actatcatcaccctaacctttgtggactcccatctgcagacacctatgtatttcttcctc
cggaacttctctttcttagaaatctcatttacaaccgtatgcatccccagatttctgggg
gcaattatcaccaggaataagactatttcctataacaactgtgcagcccaactctttttc
tttatcttcatgggggtgactgaattttacattttaactgccatgtcctatgaccgctat
gttgccatctgcaagccccttcattacacatccatcatgaacaggaaactctgcactcta
cttgtgctgtgtgcctggctaagtgggtttctgaccattttcccaccccttatgcttctc
ctccagctggattactgtgcttccaacgtcattgatcactttgcatgtgactattttccc
ctcttacaactatcttgttcagatacatggctcctagaagtaattggtttttactttgct
ttggttactttgctgttcactttggcattagtgattttatcttacatgtacattatcagg
accattttgagaatcccgtctgccagtcaaagaaaaaaggctttctccacttgttcttct
cacatgattgtcatttccatttcttatggaagctgtatattcatgtatgctaatccatct
gcaaaagaaaaggcatcattgacaaaaggaatagctattctcaatacatctgttgccccc
atgctgaaccccttcatttacactctgagaaaccagcaagtaaaacaagccttcaaaaat
gtggtccacaaagttgtgttttatgcaaatcaatga

DBGET integrated database retrieval system