KEGG   Homo sapiens (human): 2549Help
Entry
2549              CDS       T01001                                 

Gene name
GAB1, DFNB26
Definition
(RefSeq) GRB2 associated binding protein 1
  KO
K09593  GRB2-associated-binding protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa05100  Bacterial invasion of epithelial cells
hsa05205  Proteoglycans in cancer
hsa05211  Renal cell carcinoma
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
N00043  HGF-MET-PI3K signaling pathway
N00044  Mutation-activated MET to PI3K signaling pathway
N00247  HGF-overexpression to PI3K signaling pathway
N00249  MET-overexpression to PI3K signaling pathway
N00260  Amplified MET to PI3K signaling pathway
Disease
H00605  Deafness, autosomal recessive
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    2549 (GAB1)
   04012 ErbB signaling pathway
    2549 (GAB1)
   04072 Phospholipase D signaling pathway
    2549 (GAB1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    2549 (GAB1)
 09160 Human Diseases
  09161 Cancers: Overview
   05205 Proteoglycans in cancer
    2549 (GAB1)
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    2549 (GAB1)
   05226 Gastric cancer
    2549 (GAB1)
   05211 Renal cell carcinoma
    2549 (GAB1)
  09171 Infectious diseases: Bacterial
   05100 Bacterial invasion of epithelial cells
    2549 (GAB1)
  09176 Drug resistance: Antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    2549 (GAB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PH PH_11 PH_3 PH_8 PH_9 PH_13
Motif
Other DBs
NCBI-GeneID: 2549
NCBI-ProteinID: NP_002030
OMIM: 604439
HGNC: 4066
Ensembl: ENSG00000109458
Vega: OTTHUMG00000161432
Pharos: Q13480(Tbio)
UniProt: Q13480 Q9HA84
Position
4q31.21
AA seq 694 aa AA seqDB search
MSGGEVVCSGWLRKSPPEKKLKRYAWKRRWFVLRSGRLTGDPDVLEYYKNDHAKKPIRII
DLNLCQQVDAGLTFNKKEFENSYIFDINTIDRIFYLVADSEEEMNKWVRCICDICGFNPT
EEDPVKPPGSSLQAPADLPLAINTAPPSTQADSSSATLPPPYQLINVPPHLETLGIQEDP
QDYLLLINCQSKKPEPTRTHADSAKSTSSETDCNDNVPSHKNPASSQSKHGMNGFFQQQM
IYDSPPSRAPSASVDSSLYNLPRSYSHDVLPKVSPSSTEADGELYVFNTPSGTSSVETQM
RHVSISYDIPPTPGNTYQIPRTFPEGTLGQTSKLDTIPDIPPPRPPKPHPAHDRSPVETC
SIPRTASDTDSSYCIPTAGMSPSRSNTISTVDLNKLRKDASSQDCYDIPRAFPSDRSSSL
EGFHNHFKVKNVLTVGSVSSEELDENYVPMNPNSPPRQHSSSFTEPIQEANYVPMTPGTF
DFSSFGMQVPPPAHMGFRSSPKTPPRRPVPVADCEPPPVDRNLKPDRKVKPAPLEIKPLP
EWEELQAPVRSPITRSFARDSSRFPMSPRPDSVHSTTSSSDSHDSEENYVPMNPNLSSED
PNLFGSNSLDGGSSPMIKPKGDKQVEYLDLDLDSGKSTPPRKQKSSGSGSSVADERVDYV
VVDQQKTLALKSTREAWTDGRQSTESETPAKSVK
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtggtgaagtggtctgctccggatggctccgcaagtcccccccggagaaaaag
ttgaagcgttatgcatggaagaggagatggttcgtgttacgcagtggccgtttaactgga
gatccagatgttttggaatattacaaaaatgatcatgccaagaagcctattcgtattatt
gatttaaatttatgtcaacaagtagatgctggattgacatttaacaaaaaagagtttgaa
aacagctacatttttgatatcaacactattgaccggattttctacttggtagcagacagc
gaggaggagatgaataagtgggttcgttgtatttgtgacatctgtgggtttaatccaaca
gaagaagatcctgtgaagccacctggcagctctttacaagcaccagctgatttaccttta
gctataaatacagcaccaccatccacccaggcagattcatcctctgctactctacctcct
ccatatcagctaatcaatgttccaccacacctggaaactcttggcattcaggaggatcct
caagactacctgttgctcatcaactgtcaaagcaagaagcccgaacccaccagaacgcat
gctgattctgcaaaatccacctcttctgaaacagactgcaatgataacgtcccttctcat
aaaaatcctgcttcctcccagagcaaacatggaatgaatggcttttttcagcagcaaatg
atatacgactctccaccttcacgtgccccatctgcttcagttgactccagcctttataac
ctgcccaggagttattcccatgatgttttaccaaaggtgtctccatcaagtactgaagca
gatggagaactctatgtttttaataccccatctgggacatcgagtgtagagactcaaatg
aggcatgtatctattagttatgacattcctccaacacctggtaatacttatcagattcca
cgaacatttccagaaggaaccttgggacagacatcaaagctagacactattccagatatt
cctccacctcggccaccgaaaccacatccagctcatgaccgatctcctgtggaaacgtgt
agtatcccacgcaccgcctcagacactgacagtagttactgtatccctacagcagggatg
tcgccttcacgtagtaataccatttccactgtggatttaaacaaattgcgaaaagatgct
agttctcaagactgctatgatattccacgagcatttccaagtgatagatctagttcactt
gaaggcttccataaccactttaaagtcaaaaatgtgttgacagtgggaagtgtttcaagt
gaagaactggatgaaaattacgtcccaatgaatcccaattcaccaccacgacaacattcc
agcagttttacagaaccaattcaggaagcaaattatgtgccaatgactccaggaacattt
gatttttcctcatttggaatgcaagttcctcctcctgctcatatgggcttcaggtccagc
ccaaaaacccctcccagaaggccagttcctgttgcagactgtgaaccaccccccgtggat
aggaacctcaagccagacagaaaagtcaagccagcgcctttagaaataaaacctttgcca
gaatgggaagaattacaagccccagttagatctcccatcactaggagttttgctcgagac
tcttccaggtttcccatgtccccccgaccagattcagtgcatagcacaacttcaagcagt
gactcacacgacagtgaagagaattatgttcccatgaacccaaacctgtccagtgaagac
ccaaatctctttggcagtaacagtcttgatggaggaagcagccctatgatcaagcccaaa
ggagacaaacaggtggaatacttagatctcgacttagattctgggaaatccacaccacca
cgtaagcaaaagagcagtggctcaggcagcagtgtagcagatgagagagtggattatgtt
gttgttgaccaacagaagaccttggctctaaagagtacccgggaagcctggacagatggg
agacagtccacagaatcagaaacgccagcgaagagtgtgaaatga

DBGET integrated database retrieval system