KEGG   Homo sapiens (human): 254910Help
Entry
254910            CDS       T01001                                 

Gene name
LCE5A, LEP18, SPRL5A
Definition
(RefSeq) late cornified envelope 5A
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: LCE
Motif
Other DBs
NCBI-GeneID: 254910
NCBI-ProteinID: NP_848525
OMIM: 612619
HGNC: 16614
Ensembl: ENSG00000186207
Vega: OTTHUMG00000014401
Pharos: Q5TCM9(Tdark)
UniProt: Q5TCM9
Position
1q21.3
AA seq 118 aa AA seqDB search
MSCQQSQQQCQPPPKCTPKCPPKCTPKCPPKCPPKCPPQCSAPCPPPVSSCCGSSSGGCC
SSEGGGCCLSHHRPRQSLRRRPQSSSCCGSGSGQQSGGSSCCHSSGGSGCCHSSGGCC
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgtcctgccagcagagccagcagcagtgccagcctcctcccaaatgtacccctaaatgc
cctcccaagtgtactcctaagtgtcctcccaagtgtcccccaaaatgccctccccagtgt
tcagccccatgcccacctccagtctcttcctgctgtggttccagctctgggggctgctgc
agctctgagggtggtggctgctgcctgagccaccacaggccccgccagtccctccgacgc
cgacctcagagttccagctgctgtggcagtggcagtggccagcagtctgggggctccagc
tgctgccacagctctgggggctctggctgctgccacagctctggaggctgctgctga

DBGET integrated database retrieval system