KEGG   Homo sapiens (human): 255043Help
Entry
255043            CDS       T01001                                 

Gene name
TMEM86B
Definition
(RefSeq) transmembrane protein 86B
  KO
K18575  alkenylglycerophosphocholine hydrolase [EC:3.3.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00565  Ether lipid metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00565 Ether lipid metabolism
    255043 (TMEM86B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.2  lysoplasmalogenase
     255043 (TMEM86B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: YhhN
Motif
Other DBs
NCBI-GeneID: 255043
NCBI-ProteinID: NP_776165
OMIM: 617806
HGNC: 28448
Ensembl: ENSG00000180089
Vega: OTTHUMG00000187285
Pharos: Q8N661(Tbio)
UniProt: Q8N661
Position
19q13.42
AA seq 226 aa AA seqDB search
MDAGKAGQTLKTHCSAQRPDVCRWLSPFILSCCVYFCLWIPEDQLSWFAALVKCLPVLCL
AGFLWVMSPSGGYTQLLQGALVCSAVGDACLIWPAAFVPGMAAFATAHLLYVWAFGFSPL
QPGLLLLIILAPGPYLSLVLQHLEPDMVLPVAAYGLILMAMLWRGLAQGGSAGWGALLFT
LSDGVLAWDTFAQPLPHAHLVIMTTYYAAQLLITLSALRSPVPKTD
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggacgctggcaaagcggggcagaccctgaagactcactgctcagcccagcgcccagat
gtctgcaggtggctgagccccttcatcctctcctgctgcgtgtacttctgcctctggatt
cccgaggaccagctgtcctggttcgctgccctggtcaagtgcctgcccgtcctctgcctg
gctgggttcctgtgggtcatgtccccaagcgggggctacacccagctcctccagggagcc
cttgtgtgctcggctgtgggggacgcttgcctcatctggccggcagccttcgtccctggc
atggccgcctttgccaccgcccacctcctctacgtctgggccttcggcttctctcccctg
cagcccggcctgctgctgctcatcatcctggcccctggcccctacctcagccttgtgctc
cagcacctcgagccggatatggtcctgccggtggcagcctatgggctgatcctgatggcc
atgctgtggcgcggcctggcccagggcgggagtgccggctggggcgcgctgctcttcacg
ctctctgatggcgtgctggcctgggacaccttcgcccagcccctgccccatgcccacctg
gtgatcatgaccacctactatgctgcccagctcctcatcacactgtcagccctcaggagc
ccggtgcccaagactgactga

DBGET integrated database retrieval system