KEGG   Homo sapiens (human): 255189Help
Entry
255189            CDS       T01001                                 

Gene name
PLA2G4F, PLA2G4FZ
Definition
(RefSeq) phospholipase A2 group IVF
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04217  Necroptosis
hsa04270  Vascular smooth muscle contraction
hsa04370  VEGF signaling pathway
hsa04611  Platelet activation
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04724  Glutamatergic synapse
hsa04726  Serotonergic synapse
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04921  Oxytocin signaling pathway
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    255189 (PLA2G4F)
   00565 Ether lipid metabolism
    255189 (PLA2G4F)
   00590 Arachidonic acid metabolism
    255189 (PLA2G4F)
   00591 Linoleic acid metabolism
    255189 (PLA2G4F)
   00592 alpha-Linolenic acid metabolism
    255189 (PLA2G4F)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    255189 (PLA2G4F)
   04010 MAPK signaling pathway
    255189 (PLA2G4F)
   04370 VEGF signaling pathway
    255189 (PLA2G4F)
   04072 Phospholipase D signaling pathway
    255189 (PLA2G4F)
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    255189 (PLA2G4F)
 Organismal Systems
  Immune system
   04611 Platelet activation
    255189 (PLA2G4F)
   04664 Fc epsilon RI signaling pathway
    255189 (PLA2G4F)
   04666 Fc gamma R-mediated phagocytosis
    255189 (PLA2G4F)
  Endocrine system
   04912 GnRH signaling pathway
    255189 (PLA2G4F)
   04913 Ovarian Steroidogenesis
    255189 (PLA2G4F)
   04921 Oxytocin signaling pathway
    255189 (PLA2G4F)
  Circulatory system
   04270 Vascular smooth muscle contraction
    255189 (PLA2G4F)
  Nervous system
   04724 Glutamatergic synapse
    255189 (PLA2G4F)
   04726 Serotonergic synapse
    255189 (PLA2G4F)
   04730 Long-term depression
    255189 (PLA2G4F)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    255189 (PLA2G4F)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    255189 (PLA2G4F)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     255189 (PLA2G4F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 255189
NCBI-ProteinID: NP_998765
HGNC: 27396
Ensembl: ENSG00000168907
Vega: OTTHUMG00000172782
Pharos: Q68DD2(Tdark)
UniProt: Q68DD2 A5PKZ7
Position
15q15.1
AA seq 849 aa AA seqDB search
MLWALWPRWLADKMLPLLGAVLLQKREKRGPLWRHWRRETYPYYDLQVKVLRATNIRGTD
LLSKADCYVQLWLPTASPSPAQTRIVANCSDPEWNETFHYQIHGAVKNVLELTLYDKDIL
GSDQLSLLLFDLRSLKCGQPHKHTFPLNHQDSQELQVEFVLEKSQVPASEVITNGVLVAH
PCLRIQGTLRGDGTAPREEYGSRQLQLAVPGAYEKPQLLPLQPPTEPGLPPTFTFHVNPV
LSSRLHVELMELLAAVQSGPSAELEAQTSKLGEGGILLSSLPLGQEEQCSVALGEGQEVA
LSMKVEMSSGDLDLRLGFDLSDGEQEFLDRRKQVVSKALQQVLGLSEALDSGQVPVVAVL
GSGGGTRAMSSLYGSLAGLQELGLLDTVTYLSGVSGSTWCISTLYRDPAWSQVALQGPIE
RAQVHVCSSKMGALSTERLQYYTQELGVRERSGHSVSLIDLWGLLVEYLLYQEENPAKLS
DQQEAVRQGQNPYPIYTSVNVRTNLSGEDFAEWCEFTPYEVGFPKYGAYVPTELFGSELF
MGRLLQLQPEPRICYLQGMWGSAFATSLDEIFLKTAGSGLSFLEWYRGSVNITDDCQKPQ
LHNPSRLRTRLLTPQGPFSQAVLDIFTSRFTSAQSFNFTRGLCLHKDYVAGREFVAWKDT
HPDAFPNQLTPMRDCLYLVDGGFAINSPFPLALLPQRAVDLILSFDYSLEAPFEVLKMTE
KYCLDRGIPFPSIEVGPEDMEEARECYLFAKAEDPRSPIVLHFPLVNRTFRTHLAPGVER
QTAEEKAFGDFVINRPDTPYGMMNFTYEPQDFYRLVALSRYNVLNNVETLKCALQLALDR
HQARERAGA
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atgctttgggcactctggccaaggtggctggcagacaagatgctgcccctcctgggggca
gtgctgcttcagaagagagagaagaggggccctctgtggaggcactggcggcgggaaacc
tacccatactatgacctccaggtgaaggtgctgagggccacaaacatccggggcacagac
ctgctgtccaaagccgactgctatgtgcaactgtggctgcccacggcgtccccaagccct
gcccagactaggatagtggccaactgcagtgaccccgagtggaatgagaccttccactac
cagatccatggtgctgtgaagaacgtcctggagctcaccctctatgacaaggacatcctg
ggcagcgaccagctctctctgctcctgtttgacctgagaagcctcaagtgtggccaacct
cacaaacacaccttcccactcaaccaccaggattcacaagagctgcaggtggaatttgtt
ctggagaagagccaggtgcctgcatctgaagtcatcaccaacggggttctggtggctcac
ccctgtctgagaatccagggcacgctccggggagatgggacagccccacgggaagagtac
ggctctaggcagctccagctggcagtgcctggagcctacgagaagccacagctcttgccc
ctgcagcctcccacagagccaggcctcccacccacctttaccttccacgtgaacccagtg
ctgagctccaggctacacgtggagctgatggagctgctggcagctgtgcagagtggcccc
agcgcagagttggaggctcagaccagcaagctgggcgaggggggcatcctgctctcctct
ctgcccctaggccaggaggaacagtgttctgtggccctgggggagggccaggaggtggct
ctgagcatgaaggtggaaatgagctccggggacctagacctacgccttggctttgacctc
tctgacggggagcaggagtttctggacaggaggaagcaggtcgtgtccaaggccctgcag
caagtgctgggattgagtgaggctctggacagtggccaggtgcctgtagtggctgtgttg
ggttccgggggtggaacccgagccatgtcttctctgtacggcagcctggcagggttgcag
gagctcggccttctagacactgtgacctacctgagtggggtctctgggtctacctggtgc
atctccacactctacagggacccagcctggtcccaggtggccttgcagggccccattgag
cgtgcccaggttcacgtctgcagcagtaagatgggagctttgtccacggagcggctacag
tactacactcaggaactgggggtccgggagcgcagtggccacagcgtgtccctcatcgac
ctctggggcctccttgttgagtatctcctgtaccaggaggagaaccctgccaagctgtct
gaccaacaggaggcggtccgccagggtcagaacccttaccccatttacaccagtgtcaac
gtccgcaccaacttgagtggggaagattttgcagagtggtgcgagttcacgccctatgag
gttggcttccccaagtacggggcttatgttcccaccgagctcttcggctcagaactcttc
atgggacgattgctgcagctccagcctgaaccccggatctgttacctgcaaggtatgtgg
ggcagcgcctttgccaccagcctggatgagatcttcctaaagaccgccggctcgggcctc
agcttcctggagtggtacagaggcagtgtgaatatcacagacgactgccagaagcctcag
ctgcacaacccctcgaggctgcgaacgaggctcctcaccccacaggggcccttctcccag
gctgtgctggacatattcacctcccgcttcacttccgcccagagctttaacttcacccgg
ggtctctgcttgcacaaggactatgtggctggcagggagttcgtggcctggaaagacaca
cacccggacgccttccccaaccagctcacccccatgcgggactgcctgtacctggtggac
ggaggctttgccatcaactctccgttcccactggctctgctgcctcagagagcagtggac
ctcattctgtcctttgactattccttggaagccccttttgaggtcttgaagatgacagag
aagtactgcctggaccgaggaatccccttccctagcatcgaggtgggccctgaggacatg
gaggaggcccgtgagtgctatctgtttgccaaggctgaggacccccgctcccccattgtg
ctgcacttccccctggttaaccgtaccttccgcacacacctggccccaggtgtggagcga
caaacagctgaggagaaggcctttggggactttgtcatcaacaggccagacaccccctat
ggcatgatgaacttcacctatgagccccaggacttttatcggctggtggccctcagtcga
tacaacgtcctgaacaacgtggagaccttgaagtgcgccctccagctggctctggaccgg
caccaggctcgggagagggcaggggcctga

DBGET integrated database retrieval system