KEGG   Homo sapiens (human): 255313Help
Entry
255313            CDS       T01001                                 

Gene name
CT47A11, CT47.11
Definition
(RefSeq) cancer/testis antigen family 47 member A11
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: CT47
Motif
Other DBs
NCBI-GeneID: 255313
NCBI-ProteinID: NP_775842
OMIM: 300592
HGNC: 27397
Ensembl: ENSG00000226929
Vega: OTTHUMG00000022310
UniProt: Q5JQC4
Position
Xq24
AA seq 288 aa AA seqDB search
MSATGDRHPTQGDQEAPVSQEGAQAEAAGAGNQEGGDSGPDSSDVVPAAEVVGVAGPVEG
LGEEEGEQAAGLAAVPRGGSAEEDSDIGPATEEEEEEEGNEAANFDLAVVARRYPASGIH
FVLLDMVHSLLHRLSHNDHILIENRQLSRLMVGPHAAARNLWGNLPPLLLPQRLGAGAAA
RAGEGLGLIQEAASVPEPAVPADLAEMAREPAEEAAEEKLSEEATEEPDAEEPATEEPTA
QEATAPEEVTKSQPEKWDEEAQDAAGEEEKEQEKEKDAENKVKNSKGT
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccacaggggaccgacacccgacccaaggggaccaggaggccccggtaagccag
gagggagcacaggccgaggcggccggagctggtaaccaggagggcggcgactccggcccc
gacagcagcgacgtggtgcctgcggccgaggtggtcggagtcgcagggcccgtggaaggc
ctcggggaggaggagggtgagcaggcggcaggcctggccgcagtcccccggggcgggagc
gccgaggaggactcagatatcgggcccgcgacggaggaagaggaggaggaagaggggaac
gaggcggccaacttcgacttggcggtggtcgcccgtcgctacccggcgtcgggcattcac
ttcgtgctcctggacatggtccactcccttctccaccgcctctctcacaacgaccacatc
ctcatagagaaccgtcaactcagccgcctgatggtggggccacacgctgctgcgcgcaac
ctctggggcaacctccccccgctgctgctgccccagaggctgggtgcaggggccgcagcc
cgggcgggcgagggcctgggcctgatccaggaggccgcatcggtcccagagcctgcagtg
ccagctgacctggccgagatggccagggagcccgcggaggaggccgcagaggagaagctc
tcagaggaggccacagaggaaccagacgcagaggaaccggccacagaagaaccgaccgca
caggaggccacggccccagaggaagtcactaaatctcagcccgaaaagtgggatgaagag
gcccaagatgctgcaggcgaggaagagaaagaacaagaaaaagagaaggatgcggaaaac
aaggtgaagaactccaaagggacctag

DBGET integrated database retrieval system