KEGG   Homo sapiens (human): 255743Help
Entry
255743            CDS       T01001                                 

Gene name
NPNT, EGFL6L, POEM
Definition
(RefSeq) nephronectin
  KO
K06824  nephronectin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    255743 (NPNT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF_CA cEGF MAM FXa_inhibition EGF_3 EGF EGF_MSP1_1 EGF_2 C_tripleX
Motif
Other DBs
NCBI-GeneID: 255743
NCBI-ProteinID: NP_001028219
OMIM: 610306
HGNC: 27405
Ensembl: ENSG00000168743
Vega: OTTHUMG00000161189
Pharos: Q6UXI9(Tbio)
UniProt: Q6UXI9
Position
4q24
AA seq 565 aa AA seqDB search
MDFLLALVLVSSLYLQAAAEFDGRWPRQIVSSIGLCRYGGRIDCCWGWARQSWGQCQPVC
QPRCKHGECIGPNKCKCHPGYAGKTCNQDLNECGLKPRPCKHRCMNTYGSYKCYCLNGYM
LMPDGSCSSALTCSMANCQYGCDVVKGQIRCQCPSPGLQLAPDGRTCVDVDECATGRASC
PRFRQCVNTFGSYICKCHKGFDLMYIGGKYQCHDIDECSLGQYQCSSFARCYNIRGSYKC
KCKEGYQGDGLTCVYIPKVMIEPSGPIHVPKGNGTILKGDTGNNNWIPDVGSTWWPPKTP
YIPPIITNRPTSKPTTRPTPKPTPIPTPPPPPPLPTELRTPLPPTTPERPTTGLTTIAPA
ASTPPGGITVDNRVQTDPQKPRGDVFIPRQPSNDLFEIFEIERGVSADDEAKDDPGVLVH
SCNFDHGLCGWIREKDNDLHWEPIRDPAGGQYLTVSAAKAPGGKAARLVLPLGRLMHSGD
LCLSFRHKVTGLHSGTLQVFVRKHGAHGAALWGRNGGHGWRQTQITLRGADIKSVVFKGE
KRRGHTGEIGLDDVSLKKGHCSEER
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atggattttctcctggcgctggtgctggtatcctcgctctacctgcaggcggccgccgag
ttcgacgggaggtggcccaggcaaatagtgtcatcgattggcctatgtcgttatggtggg
aggattgactgctgctggggctgggctcgccagtcttggggacagtgtcagcctgtgtgc
caaccacgatgcaaacatggtgaatgtatcgggccaaacaagtgcaagtgtcatcctggt
tatgctggaaaaacctgtaatcaagatctaaatgagtgtggcctgaagccccggccctgt
aagcacaggtgcatgaacacttacggcagctacaagtgctactgtctcaacggatatatg
ctcatgccggatggttcctgctcaagtgccctgacctgctccatggcaaactgtcagtat
ggctgtgatgttgttaaaggacaaatacggtgccagtgcccatcccctggcctgcagctg
gctcctgatgggaggacctgtgtagatgttgatgaatgtgctacaggaagagcctcctgc
cctagatttaggcaatgtgtcaacacttttgggagctacatctgcaagtgtcataaaggc
ttcgatctcatgtatattggaggcaaatatcaatgtcatgacatagacgaatgctcactt
ggtcagtatcagtgcagcagctttgctcgatgttataacatacgtgggtcctacaagtgc
aaatgtaaagaaggataccagggtgatggactgacttgtgtgtatatcccaaaagttatg
attgaaccttcaggtccaattcatgtaccaaagggaaatggtaccattttaaagggtgac
acaggaaataataattggattcctgatgttggaagtacttggtggcctccgaagacacca
tatattcctcctatcattaccaacaggcctacttctaagccaacaacaagacctacacca
aagccaacaccaattcctactccaccaccaccaccacccctgccaacagagctcagaaca
cctctaccacctacaaccccagaaaggccaaccaccggactgacaactatagcaccagct
gccagtacacctccaggagggattacagttgacaacagggtacagacagaccctcagaaa
cccagaggagatgtgttcattccacggcaaccttcaaatgacttgtttgaaatatttgaa
atagaaagaggagtcagtgcagacgatgaagcaaaggatgatccaggtgttctggtacac
agttgtaattttgaccatggactttgtggatggatcagggagaaagacaatgacttgcac
tgggaaccaatcagggacccagcaggtggacaatatctgacagtgtcggcagccaaagcc
ccagggggaaaagctgcacgcttggtgctacctctcggccgcctcatgcattcaggggac
ctgtgcctgtcattcaggcacaaggtgacggggctgcactctggcacactccaggtgttt
gtgagaaaacacggtgcccacggagcagccctgtggggaagaaatggtggccatggctgg
aggcaaacacagatcaccttgcgaggggctgacatcaagagcgtcgtcttcaaaggtgaa
aaaaggcgtggtcacactggggagattggattagatgatgtgagcttgaaaaaaggccac
tgctctgaagaacgctaa

DBGET integrated database retrieval system