KEGG   Homo sapiens (human): 255758
Entry
255758            CDS       T01001                                 

Gene name
DYNLT2B, SRTD17, TCTEX1D2
Definition
(RefSeq) dynein light chain Tctex-type 2B
  KO
K22866  tctex1 domain-containing protein 2
Organism
hsa  Homo sapiens (human)
Disease
H02157  Short-rib thoracic dysplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    255758 (DYNLT2B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    255758 (DYNLT2B)
SSDB
Motif
Pfam: Tctex-1
Other DBs
NCBI-GeneID: 255758
NCBI-ProteinID: NP_689986
OMIM: 617353
HGNC: 28482
Ensembl: ENSG00000213123
Vega: OTTHUMG00000186382
Pharos: Q8WW35(Tdark)
UniProt: Q8WW35
Position
3q29
AA seq 142 aa
MATSIGVSFSVGDGVPEAEKNAGEPENTYILRPVFQQRFRPSVVKDCIHAVLKEELANAE
YSPEEMPQLTKHLSENIKDKLKEMGFDRYKMVVQVVIGEQRGEGVFMASRCFWDADTDNY
THDVFMNDSLFCVVAAFGCFYY
NT seq 429 nt   +upstreamnt  +downstreamnt
atggccacgtccatcggagtgtccttctcggtgggcgacggggtgcctgaggctgagaag
aacgcaggggagcccgagaacacctatattctgcggcctgttttccagcagaggttcagg
ccctctgtggttaaagactgtatccatgctgtgctcaaggaggaactggcaaatgctgaa
tattctccagaagaaatgcctcagcttacaaaacatttatcagaaaacattaaagataaa
ttaaaagaaatgggatttgaccgatacaaaatggtggtgcaagtagtgattggagaacaa
agaggtgaaggagtattcatggcttctcgctgtttctgggatgctgacactgacaactat
actcatgatgttttcatgaatgacagtttattctgcgttgtagcagcatttggctgtttc
tactactga

DBGET integrated database retrieval system