KEGG   Homo sapiens (human): 255919
Entry
255919            CDS       T01001                                 

Gene name
CNEP1R1, C16orf69, NEP1-R1, NEP1R1, TMEM188, TMP125
Definition
(RefSeq) CTD nuclear envelope phosphatase 1 regulatory subunit 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Tmemb_18A DUF5392
Other DBs
NCBI-GeneID: 255919
NCBI-ProteinID: NP_001268718
OMIM: 616869
HGNC: 26759
Ensembl: ENSG00000205423
Vega: OTTHUMG00000173447
Pharos: Q8N9A8(Tbio)
UniProt: Q8N9A8 B8YCP3
Position
16q12.1
AA seq 125 aa
MNSLEQAEDLKAFERRLTEYIHCLQPATGRWRMLLIVVSVCTATGAWNWLIDPETQKVSF
FTSLWNHPFFTISCITLIGLFFAGIHKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKP
RPHVQ
NT seq 378 nt   +upstreamnt  +downstreamnt
atgaactcgctggagcaggcggaagatctcaaggcttttgagaggagacttactgaatat
attcattgtttgcaacctgctactggacgctggagaatgcttcttatagtggtatctgtc
tgtacagctactggtgcctggaactggttaatagaccctgagacacaaaaggtgtccttc
ttcacatcattatggaatcacccatttttcaccattagctgtatcactctaataggcttg
ttctttgctggaatacacaagagagtagttgcaccatcaattatagctgctcgatgtcga
acggtattagcagaatacaatatgtcttgtgatgatacaggaaaactaattttgaaacct
aggcctcatgttcaatga

DBGET integrated database retrieval system