KEGG   Homo sapiens (human): 256051Help
Entry
256051            CDS       T01001                                 

Gene name
ZNF549
Definition
(RefSeq) zinc finger protein 549
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    256051 (ZNF549)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Other Cys2His2 zinc factors
    256051 (ZNF549)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 zf-C2H2_jaz Zn-ribbon_8 zf_UBZ zf-C2H2_8 zinc_ribbon_15
Motif
Other DBs
NCBI-GeneID: 256051
NCBI-ProteinID: NP_001186224
HGNC: 26632
Ensembl: ENSG00000121406
Vega: OTTHUMG00000183465
Pharos: Q6P9A3(Tdark)
UniProt: Q6P9A3
Position
19q13.43
AA seq 640 aa AA seqDB search
MAEAALVNTPQIPMVTEEFVKPSQGHVTFEDIAVYFSQEEWGLLDEAQRCLYHDVMLENF
SLMASVGCLHGIEAEEAPSEQTLSAQGVSQARTPKLGPSIPNAHSCEMCILVMKDILYLS
EHQGTLPWQKPYTSVASGKWFSFGSNLQQHQNQDSGEKHIRKEESSALLLNSCKIPLSDN
LFPCKDVEKDFPTILGLLQHQTTHSRQEYAHRSRETFQQRRYKCEQVFNEKVHVTEHQRV
HTGEKAYKRREYGKSLNSKYLFVEHQRTHNAEKPYVCNICGKSFLHKQTLVGHQQRIHTR
ERSYVCIECGKSLSSKYSLVEHQRTHNGEKPYVCNVCGKSFRHKQTFVGHQQRIHTGERP
YVCMECGKSFIHSYDRIRHQRVHTGEGAYQCSECGKSFIYKQSLLDHHRIHTGERPYECK
ECGKAFIHKKRLLEHQRIHTGEKPYVCIICGKSFIRSSDYMRHQRIHTGERAYECSDCGK
AFISKQTLLKHHKIHTRERPYECSECGKGFYLEVKLLQHQRIHTREQLCECNECGKVFSH
QKRLLEHQKVHTGEKPCECSECGKCFRHRTSLIQHQKVHSGERPYNCTACEKAFIYKNKL
VEHQRIHTGEKPYECGKCGKAFNKRYSLVRHQKVHITEEP
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggcagcgctagtgaatacgccgcagattcccatggtaacagaagagtttgtg
aaaccatcacagggccatgtgacctttgaggatattgctgtgtacttctcccaggaggag
tggggcctccttgatgaagctcaaaggtgcctgtatcatgatgtgatgctggagaacttt
tcgcttatggcctcagtaggttgtttgcatggaatagaggctgaggaggccccttctgag
cagactctttctgcgcaaggagtgtcacaggccaggactccaaagctaggtccttccatc
ccaaatgctcattcttgtgagatgtgtatcctggtcatgaaagacattttgtacctcagt
gagcatcaggggacacttccctggcagaaaccttatacgtctgtggccagtgggaaatgg
ttttcatttggttctaacctgcaacagcaccagaaccaggacagtggagagaaacacatc
agaaaggaggagagcagtgccttgcttctgaatagctgcaaaattcctctgtcagacaat
cttttcccatgcaaagatgttgagaaggattttccaaccatcctgggccttctccaacac
cagaccacccacagcagacaagagtatgcacatagaagcagggagacctttcaacaaaga
cgttacaaatgtgagcaagttttcaatgagaaagttcatgttactgagcatcagagagtc
cacactggagaaaaagcttataagcgtagggaatatgggaaatccttgaactctaaatac
ttatttgttgaacaccagagaacccataatgcagaaaagccttatgtgtgcaatatatgt
gggaaatcattcctccataaacaaacactcgttgggcaccagcagagaattcacactaga
gaaaggtcttatgtgtgcatcgaatgtgggaaatccttgagctccaaatactcacttgtg
gaacaccagagaacccataatggagaaaagccttatgtgtgcaatgtatgtgggaaatca
ttccgccacaaacaaacatttgttggccatcagcagagaatccacactggagagaggcct
tatgtgtgtatggaatgtgggaaatcttttattcattcctatgaccgcattcgacaccag
agagttcacactggagaaggggcttatcagtgcagtgaatgtgggaaatccttcatatac
aaacagtcacttcttgatcaccatagaatccacacgggagaaaggccttatgagtgcaaa
gaatgtgggaaggccttcattcacaaaaaaagacttcttgagcaccagagaattcatact
ggagaaaagccttatgtgtgcatcatatgtgggaaatcatttatccgctcgtctgactac
atgcgacaccagagaattcacactggagaaagggcttatgaatgcagtgactgtgggaaa
gccttcatctccaaacaaacacttcttaagcatcacaaaatccacactagagaaaggcct
tatgaatgcagtgaatgtggaaaaggcttctaccttgaggttaaacttcttcagcaccaa
agaatccatactagagaacaactttgtgagtgcaatgaatgtggaaaagtcttcagccac
caaaaaagacttcttgagcaccagaaagttcacactggcgaaaagccctgtgagtgcagt
gaatgtgggaaatgctttagacaccgcaccagcctcattcaacaccagaaagttcacagt
ggagagaggccttataactgcactgcatgtgagaaggcctttatctataaaaacaaactt
gttgagcatcagcgaatccacaccggagaaaagccgtatgaatgtggtaaatgtgggaaa
gccttcaacaaaagatattcccttgtcaggcaccagaaggtacatataacagaagagccc
tag

DBGET integrated database retrieval system