KEGG   Homo sapiens (human): 256076Help
Entry
256076            CDS       T01001                                 

Gene name
COL6A5, COL29A1, VWA4
Definition
(RefSeq) collagen type VI alpha 5 chain
  KO
K06238  collagen, type VI, alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04974  Protein digestion and absorption
hsa05165  Human papillomavirus infection
Disease
H01358  Atopic dermatitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    256076 (COL6A5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    256076 (COL6A5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    256076 (COL6A5)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    256076 (COL6A5)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    256076 (COL6A5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    256076 (COL6A5)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    256076 (COL6A5)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   256076 (COL6A5)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   256076 (COL6A5)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   256076 (COL6A5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VWA VWA_2 Collagen VWA_3 VWA_CoxE Copine vWA-TerF-like
Motif
Other DBs
NCBI-GeneID: 256076
NCBI-ProteinID: NP_001265227
OMIM: 611916
HGNC: 26674
Ensembl: ENSG00000172752
Vega: OTTHUMG00000159712
Pharos: A8TX70(Tbio)
UniProt: A8TX70
Position
3q22.1
AA seq 2614 aa AA seqDB search
MKILLIIFVLIIWTETLADQSPGPGPVYADVVFLVDSSDHLGPKSFPFVKTFINKMINSL
PIEANKYRVALAQYSDEFHSEFHLSTFKGRSPMLNHLKKNFQFIGGSLQIGKALQEAHRT
YFSAPINGRDRKQFPPILVVLASAESEDEVEEASKALQKDGVKIISVGVQKASEENLKAM
ATSHFHFNLRTIRDLSTFSQNMTQIIKDVTKYKEGAVDADMQVHFPISCQKDSLADLVFL
VDESLGTGGNLRHLQTFLENITSSMDVKENCMRLGLMSYSNSAKTISFLKSSTTQSEFQQ
QIKNLSIQVGKSNTGAAIDQMRRDGFSESYGSRRAQGVPQIAVLVTHRPSDDEVHDAALN
LRLEDVNVFALSIQGANNTQLEEIVSYPPEQTISTLKSYADLETYSTKFLKKLQNEIWSQ
ISTYAEQRNLDKTGCVDTKEADIHFLIDGSSSIQEKQFEQIKRFMLEVTEMFSIGPDKVR
VGVVQYSDDTEVEFYITDYSNDIDLRKAIFNIKQLTGGTYTGKALDYILQIIKNGMKDRM
SKVPCYLIVLTDGMSTDRVVEPAKRLRAEQITVHAVGIGAANKIELQEIAGKEERVSFGQ
NFDALKSIKNEVVREICAEKGCEDMKADIMFLVDSSWSIGNENFRKMKIFMKNLLTKIQI
GADKTQIGVVQFSDKTKEEFQLNRYFTQQEISDAIDRMSLINEGTLTGKALNFVGQYFTH
SKGARLGAKKFLILITDGVAQDDVRDPARILRGKDVTIFSVGVYNANRSQLEEISGDSSL
VFHVENFDHLKALERKLIFRVCALHDCKRITLLDVVFVLDHSGSIKKQYQDHMINLTIHL
VKKADVGRDRVQFGALKYSDQPNILFYLNTYSNRSAIIENLRKRRDTGGNTYTAKALKHA
NALFTEEHGSRIKQNVKQMLIVITDGESHDHDQLNDTALELRNKGITIFAVGVGKANQKE
LEGMAGNKNNTIYVDNFDKLKDVFTLVQERMCTEAPEVCHLQEADVIFLCDGSDRVSNSD
FVTMTTFLSDLIDNFDIQSQRMKIGMAQFGSNYQSIIELKNSLTKTQWKTQIQNVSKSGG
FPRIDFALKKVSNMFNLHAGGRRNAGVPQTLVVITSGDPRYDVADAVKTLKDLGICVLVL
GIGDVYKEHLLPITGNSEKIITFQDFDKLKNVDVKKRIIREICQSCGKTNCFMDIVVGFD
ISTHVQGQPLFQGHPQLESYLPGILEDISSIKGVSCGAGTEAQVSLAFKVNSDQGFPAKF
QIYQKAVFDSLLQVNVSGPTHLNAQFLRSLWDTFKDKSASRGQVLLIFSDGLQSESNIML
ENQSDRLREAGLDALLVVSLNTTAHHEFSSFEFGKRFDYRTHLTIGMRELGKKLSQYLGN
IAERTCCCTFCKCPGIPGPHGTRGLQAMKGSQGLKGSRGHRGEDGNPGVRGDTGPQGDKG
IAGCPGAWGQKGLKGFSGPKGGHGDDGIDGLDGEEGCHGFPGIKGEKGDPGSQGSPGSRG
APGQYGEKGFPGDPGNPGQNNNIKGQKGSKGEQGRQGRSGQKGVQGSPSSRGSRGREGQR
GLRGVSGEPGNPGPTGTLGAEGLQGPQGSQGNPGRKGEKGSQGQKGPQGSPGLMGAKGST
GRPGLLGKKGEPGLPGDLGPVGQTGQRGRQGDSGIPGYGQMGRKGVKGPRGFPGDAGQKG
DIGNPGIPGGPGPKGFRGLALTVGLKGEEGSRGLPGPPGQRGIKGMAGQPVYSQCDLIRF
LREHSPCWKEKCPAYPTELVFALDNSYDVTEESFNKTRDIITSIVNDLNIRENNCPVGAR
VAMVSYNSGTSYLIRWSDYNRKKQLLQQLSQIKYQDTTEPRDVGNAMRFVTRNVFKRTYA
GANVRRVAVFFSNGQTASRSSIITATMEFSALDISPTVFAFDERVFLEAFGFDNTGTFQV
IPVPPNGENQTLERLRRCALCYDKCFPNACIREAFLPEDSYMDVVFLIDNSRNIAKDEFK
AVKALVSSVIDNFNIASDPLISDSGDRIALLSYSPWESSRRKMGTVKTEFDFITYDNQLL
MKNHIQTSFQQLNGEATIGRALLWTTENLFPETPYLRKHKVIFVVSAGENYERKEFVKMM
ALRAKCQGYVIFVISLGSTRKDDMEELASYPLDQHLIQLGRIHKPDLNYIAKFLKPFLYS
VRRGFNQYPPPMLEDACRLINLGGENIQNDGFQFVTELQEDFLGGNGFIGQELNSGRESP
FVKTEDNGSDYLVYLPSQMFEPQKLMINYEKDQKSAEIASLTSGHENYGRKEEPDHTYEP
GDVSLQEYYMDVAFLIDASQRVGSDEFKEVKAFITSVLDYFHIAPTPLTSTLGDRVAVLS
YSPPGYMPNTEECPVYLEFDLVTYNSIHQMKHHLQDSQQLNGDVFIGHALQWTIDNVFVG
TPNLRKNKVIFVISAGETNSLDKDVLRNVSLRAKCQGYSIFVFSFGPKHNDKELEELASH
PLDHHLVQLGRTHKPDWNYIIKFVKPFVHLIRRAINKYPTEDMKATCVNMTSPNPENGGT
ENTVLLLPGIYEIKTENGDLFDEFDSQAQHLLVLGNNHSSGSETATDLMQKLYLLFSTEK
LAMKDKEKAHLEEISALVVDKQQEKEDGEDTRSS
NT seq 7845 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcttgctaattatatttgtcctaatcatttggactgaaacattggcagaccag
agcccagggccaggccctgtgtatgcagatgtcgtgtttctggtggacagctccgatcac
ctgggacctaagtcattcccattcgtgaaaacgttcatcaacaaaatgatcaacagtctc
cccatagaggccaacaaataccgtgtagccctggcccagtacagcgacgagtttcacagt
gaattccatctgagcaccttcaaaggcagaagccccatgctgaaccacctcaagaagaac
tttcagttcattggcgggtccctgcagataggaaaggctcttcaggaggctcataggacc
tacttctctgcacccataaatgggagagacaggaaacagtttcccccaattttggtggtc
ctggcttcggctgagtctgaggatgaagtggaagaggcttcgaaagccctgcagaaagac
ggggtgaaaattatctccgtgggggtgcagaaagcttctgaggaaaatctgaaggccatg
gccacatcccatttccatttcaaccttcggacaatcagagacctcagcacattttcccaa
aacatgacacagatcatcaaggatgtaaccaagtataaggagggagccgtcgatgctgat
atgcaagttcacttccccatatcctgtcagaaagattcactcgctgacctcgtgttcctg
gtggatgagtcacttgggaccggaggaaatttaaggcatcttcagaccttccttgagaac
attaccagctccatggatgtgaaggaaaattgcatgcgacttggactgatgagttacagc
aatagtgccaagactatttcttttcttaaatcaagcacaacccaatctgaatttcagcag
caaatcaagaatctttctatccaagttgggaaatccaatacaggggctgccattgatcag
atgagaagagacggcttctcagagtcatatggcagcagaagagcacaaggagtgcctcag
attgcagttctggtcacccacagaccatcagatgatgaggtgcatgatgctgcgctgaac
cttcgactggaggatgtaaacgtgtttgccttgagcatccaaggggctaacaatacccag
ttagaagaaatagtgtcttatcctccagaacagacaatttccacgctgaagtcctatgca
gacttagaaacttacagtacaaagttcctgaaaaagctccagaatgaaatatggtcccaa
atttctacttatgctgaacaaaggaatcttgataaaactggctgtgtggatacaaaagag
gctgatatccacttcctcattgatggctcaagcagcatccaggagaaacagtttgagcaa
atcaagagatttatgttggaagtgacagaaatgtttagcattggcccagacaaagtccga
gttggagttgtgcagtattcagatgacacagaagtggaattttatatcactgactattct
aatgatattgacttaagaaaggctatttttaacattaagcaactaactggtggaacttat
actgggaaagctctggattacatactgcaaataataaaaaatggaatgaaggatagaatg
agcaaggttccctgttacctcattgtgttgactgatgggatgtccacagacagagtcgtg
gaacctgctaagagactaagggctgagcaaatcactgttcatgcagttggcattggggca
gctaataaaatagaactgcaagaaattgctgggaaagaagaaagggttagctttgggcag
aactttgatgctttgaaaagcataaaaaatgaagtcgttcgtgaaatctgcgctgaaaaa
ggatgtgaagacatgaaggccgacatcatgtttctggtggacagttcttggagtatagga
aatgaaaattttaggaaaatgaaaatcttcatgaaaaacctgttaactaaaattcaaatt
ggtgcagacaaaacccagattggtgttgttcagttcagtgataaaactaaggaagagttc
cagcttaatagatattttacacagcaagaaatttctgatgcaatagatagaatgtctctc
atcaatgaaggcactttaactggaaaggcactaaattttgtaggtcaatacttcacccac
tccaagggggcccgtttgggggccaaaaaatttctcatcctcatcacagatggagtagcg
caggatgatgtgagagatcctgctagaattcttcggggcaaagatgtgaccatcttctct
gtaggagtatacaatgccaatagatctcagctagaagagatcagtggggatagcagccta
gtttttcatgttgagaacttcgatcatctaaaggcactagaaaggaaacttatctttcgt
gtgtgtgctctccatgattgtaaaaggattacactactagacgttgtgtttgtgctggat
cattcaggtagcataaaaaaacaatatcaagatcacatgattaacctaactatccatttg
gtgaagaaagcagatgttggcagggaccgagttcagtttggagccctcaaatactctgac
caacctaacatccttttctaccttaatacatactcgaacagatcagcaataattgagaat
ctgcggaagcgcagggacactggagggaacacctacactgccaaggctctcaagcacgca
aatgccctgtttacagaggaacatggcagccgcatcaagcaaaatgtgaagcagatgctg
attgtcatcaccgatggggaatcccatgaccatgatcagctcaatgacacagcattggaa
ctgagaaacaaaggcatcaccatctttgcagtgggtgtaggaaaggccaaccaaaaggaa
cttgagggtatggcagggaataaaaacaatactatctatgtagataattttgacaaactg
aaagatgttttcacacttgttcaagaacgtatgtgtactgaagcaccagaggtctgtcat
cttcaggaagctgacgtgattttcctttgcgatggctctgacagggtatctaattcagat
tttgtaaccatgacaactttcttgtcagacttaatcgataattttgacattcagtctcaa
agaatgaaaattggtatggctcaatttggaagcaactaccagagtattattgagttgaaa
aactctctgactaaaacccagtggaagactcaaattcagaatgtctccaagagcggtgga
tttccaagaattgactttgcccttaaaaaagtgagcaatatgtttaatctacatgctggt
gggagaagaaatgctggtgtcccccaaactttggttgttatcacatctggagatcctcgc
tatgatgtggcagatgcagtaaaaaccctgaaggaccttggaatttgtgtcctggttttg
ggcataggagatgtttataaggaacatctcctgccaataacaggcaattctgaaaaaata
atcacttttcaagactttgataaattaaagaatgtggatgtgaaaaaaagaatcatccgt
gaaatctgccagagctgtgggaaaaccaattgctttatggacatagtggttgggtttgac
atctccactcatgtgcaggggcagcctttgttccagggccacccccagctggaatcctac
ctcccaggcatcttagaagacatcagctctatcaagggggtgagctgtggggctggcaca
gaggcacaggtgagcttggcgtttaaggtgaacagtgaccaaggattccctgccaagttc
caaatctatcagaaagcagtgtttgacagcttgctgcaagtcaacgtcagtgggccaact
catctgaacgcacagttcttgcggtctctttgggacacatttaaggataaatctgcatcc
cggggccaggtgctgcttattttttcagacggtctccagagtgaaagcaacataatgctt
gaaaatcaatcagacaggctcagagaagcaggacttgatgctctgctggtagtgtccctt
aacacaactgctcatcatgagttttctagctttgaatttggaaaaagattcgattacagg
actcatctgactattggaatgagagaactgggcaaaaaactatcacagtacctgggaaat
attgcagagaggacttgctgctgtacattctgcaaatgtccaggaattccaggacctcat
gggacccgaggactacaagccatgaagggttctcaaggtctgaaaggcagcagaggacac
aggggagaggatggaaaccctggagtacgaggagacacaggaccccaaggagacaaaggg
attgcaggatgtccaggggcgtggggtcagaagggactcaaaggattttctggacctaag
ggaggtcatggagacgatgggattgatggacttgatggggaagagggctgtcatggattt
cctggaataaaaggagaaaaaggtgatccaggatctcagggcagcccaggttccagaggt
gcccctgggcagtatggagagaagggcttcccaggggatccgggtaatccaggacaaaac
aataacatcaaaggacaaaagggctccaaaggagaacaaggaagacaaggtagaagtgga
cagaaaggggtgcaaggcagtcctagttccagaggcagcaggggaagagaaggtcaaagg
ggactccgaggtgtctcaggagaaccaggaaatcctggacctacaggcacattgggagct
gaaggattacaaggcccacaggggtcacagggaaatcctggcagaaaaggagaaaaagga
agccaggggcagaaaggacctcagggttctcctgggctaatgggagctaaagggagcact
ggaagacctggacttttggggaaaaaaggagagcctggacttcctggagatctagggcca
gtggggcaaactgggcagcgaggaagacagggagattctggcatcccaggctacggtcag
atgggacgaaaaggagtaaagggcccaagaggattccctggagatgcggggcagaagggt
gatattggtaatcctggaattcctgggggacctggacccaaaggatttaggggactagca
ctcactgtaggcttgaaaggtgaagagggatctcgaggactcccaggccctcctggacag
agaggcattaaaggcatggcagggcagcctgtatattctcaatgtgatctgatccggttt
ttgcgggaacatagtccttgctggaaagaaaaatgtccagcatatccaacagagctagta
tttgctctggacaattcctacgatgtcacagaagagagctttaataaaacacgggacatc
atcacttccattgtcaatgaccttaacatcagggaaaataactgtcctgtgggagcaaga
gttgccatggtttcctataactcaggcaccagctatctcatccgctggtctgactacaat
aggaagaagcagctcctccagcagctttcccaaataaaatatcaagacaccacagagccc
cgagatgttggtaatgcaatgaggtttgtgacccgcaacgtgttcaagcggacgtatgca
ggagccaacgtgaggagagttgctgtgttttttagcaatggtcaaacagccagtaggtca
tccatcatcacggccaccatggagtttagtgccctggatatcagtccaacagtctttgct
tttgatgagagagttttccttgaagcttttgggtttgacaacactggaacatttcaggtg
attccagttcctccaaatggggaaaatcaaacattagaaagacttcggcgctgtgcactt
tgctatgataaatgttttccaaatgcttgcattcgagaggctttcttacctgaagattca
tacatggatgtagtcttcctcatagacaattctcggaatatagcaaaggatgagtttaag
gctgtgaaagccttggtgagctcagtgattgacaacttcaacattgcttcagacccttta
atctcagactctggtgataggattgctttgttgagctattctccttgggaaagttccagg
agaaagatgggtacagtaaaaacagagtttgatttcatcacttatgacaaccaactccta
atgaagaatcacatccagacttccttccaacagctaaatggagaagcaacaattggtcgt
gccctactgtggaccactgaaaatctttttccagaaacaccctatctaagaaaacacaag
gtcatctttgtggtctcagctggagaaaattatgagagaaaagaatttgtaaaaatgatg
gctttgagggctaagtgtcaaggctacgtcatatttgtgatttctctgggctctacacgt
aaggatgacatggaggagttagccagctacccacttgatcaacacctgatacagcttggg
agaatacataaaccagatctgaattatattgcgaagttcttaaagccatttttatactcg
gtcaggcggggattcaatcagtacccaccaccgatgcttgaggatgcctgtagactcatc
aatttaggaggagagaatattcaaaatgatggtttccaatttgttactgagctacaagag
gattttttgggaggtaatggcttcattggccaagaattaaattctgggagagaatcacct
tttgtaaagacggaagacaatggaagtgactatttggtttaccttccaagccaaatgttt
gagccacaaaaattaatgatcaattatgaaaaagatcaaaaatctgcagaaattgcaagt
ctcacttctggacatgaaaattatggcagaaaagaagaaccagatcatacttatgaacct
ggagatgtctctcttcaagaatattacatggatgtggctttcctcatagatgcttcccaa
agagtaggaagtgatgagtttaaggaagtaaaagcttttataacctcagtgcttgattac
tttcacattgcccccactccactgacctccaccttaggagacagggttgctgtcctgagc
tactctcctccaggctatatgcctaacactgaagaatgccctgtctacctggaatttgat
ttggttacttataacagtatacaccaaatgaaacatcatctccaagactctcaacagctc
aatggagatgtttttattggccatgccttgcagtggacaattgacaatgtctttgtagga
acccccaatctgaggaaaaacaaagttatctttgtaatatctgctggcgaaaccaactct
ttagacaaagacgtcttaaggaatgtgtctctgagagccaagtgtcaaggctactccata
tttgtgttttcctttggccctaaacacaatgacaaagaattagaagaattagccagccac
cctctggatcatcacttggtccaacttggccgaacccacaagccagattggaactatatc
atcaagtttgtcaagccatttgtccatttaatcagacgtgccatcaacaaatatcccacc
gaagatatgaaagccacatgtgttaacatgacctctcccaacccagagaacggtggcaca
gaaaacactgtattacttcttcctgggatatatgaaataaagacagaaaatggtgatctg
tttgatgaatttgattcccaggcacaacatctccttgtattagggaacaatcatagtagt
ggttctgagacagctactgatttgatgcagaagttatatctgctcttttcaactgagaaa
ctggcaatgaaagacaaggaaaaagcacatttagaagaaatttcagctctagtggttgat
aaacagcaagaaaaagaagatggtgaagatacaaggtcatcatag

DBGET integrated database retrieval system