KEGG   Homo sapiens (human): 256302
Entry
256302            CDS       T01001                                 
Symbol
NATD1, C17orf103, Gtlf3b
Name
(RefSeq) N-acetyltransferase domain containing 1
  KO
K06975  uncharacterized protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    256302 (NATD1)
SSDB
Motif
Pfam: Acetyltransf_CG Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 DUF3222
Other DBs
NCBI-GeneID: 256302
NCBI-ProteinID: NP_690878
HGNC: 30770
Ensembl: ENSG00000274180
UniProt: Q8N6N6
Position
17:complement(21238870..21253410)
AA seq 113 aa
MAHSAAAVPLGALEQGCPIRVEHDRRRRQFTVRLNGCHDRAVLLYEYVGKRIVDLQHTEV
PDAYRGRGIAKHLAKAALDFVVEEDLKAHLTCWYIQKYVKENPLPQYLERLQP
NT seq 342 nt   +upstreamnt  +downstreamnt
atggcgcactcggctgccgccgtgccgctgggcgcgctggagcagggctgccccatccgc
gtggagcacgaccgccggcgccgccagttcactgtccggctcaacggatgtcatgaccgg
gccgtcctgctctatgagtacgtgggcaagcggatcgtggacctgcagcacaccgaggtc
ccagatgcctaccgtgggcgtggcatcgccaagcaccttgccaaggccgccctggacttc
gtggtggaggaggacctgaaggcccatctcacctgctggtacatccagaagtacgtcaag
gagaaccccctgccgcagtacctggagcgcctgcagccgtaa

DBGET integrated database retrieval system