KEGG   Homo sapiens (human): 256471
Entry
256471            CDS       T01001                                 
Symbol
MFSD8, CCMD, CLN7
Name
(RefSeq) major facilitator superfamily domain containing 8
  KO
K12307  MFS transporter, ceroid-lipofuscinosis neuronal protein 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
Disease
H00149  Neuronal ceroid lipofuscinosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    256471 (MFSD8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    256471 (MFSD8)
Transporters [BR:hsa02000]
 Major facilitator superfamily (MFS)
  Unknown transporters
   Others
    256471 (MFSD8)
SSDB
Motif
Pfam: MFS_1 Sugar_tr
Other DBs
NCBI-GeneID: 256471
NCBI-ProteinID: NP_689991
OMIM: 611124
HGNC: 28486
Ensembl: ENSG00000164073
Pharos: Q8NHS3(Tbio)
UniProt: Q8NHS3
Position
4:complement(127917732..127965963)
AA seq 518 aa
MAGLRNESEQEPLLGDTPGSREWDILETEEHYKSRWRSIRILYLTMFLSSVGFSVVMMSI
WPYLQKIDPTADTSFLGWVIASYSLGQMVASPIFGLWSNYRPRKEPLIVSILISVAANCL
YAYLHIPASHNKYYMLVARGLLGIGAGNVAVVRSYTAGATSLQERTSSMANISMCQALGF
ILGPVFQTCFTFLGEKGVTWDVIKLQINMYTTPVLLSAFLGILNIILILAILREHRVDDS
GRQCKSINFEEASTDEAQVPQGNIDQVAVVAINVLFFVTLFIFALFETIITPLTMDMYAW
TQEQAVLYNGIILAALGVEAVVIFLGVKLLSKKIGERAILLGGLIVVWVGFFILLPWGNQ
FPKIQWEDLHNNSIPNTTFGEIIIGLWKSPMEDDNERPTGCSIEQAWCLYTPVIHLAQFL
TSAVLIGLGYPVCNLMSYTLYSKILGPKPQGVYMGWLTASGSGARILGPMFISQVYAHWG
PRWAFSLVCGIIVLTITLLGVVYKRLIALSVRYGRIQE
NT seq 1557 nt   +upstreamnt  +downstreamnt
atggccggcctgcggaacgaaagtgaacaggagccgctcttaggcgacacacctggaagc
agagaatgggacattttagagactgaagagcattataagagccgatggagatctattagg
attttatatcttactatgtttctcagcagtgtagggttttctgtagtgatgatgtccata
tggccatatctccaaaagattgatccgacagctgatacaagttttttgggctgggttatt
gcttcatatagtcttggccaaatggtagcttcacctatatttggtttatggtctaattat
agaccaagaaaagagcctcttattgtctccatcttgatttccgtggcagccaactgcctc
tatgcatatctccacatcccagcttctcataataaatactacatgctggttgctcgtgga
ttgttgggaattggagcaggaaatgtagcagttgttagatcatatactgctggtgctact
tcccttcaggaaagaacaagttccatggcaaacataagcatgtgtcaagcattaggtttt
attctaggtccagtttttcagacttgttttacattccttggagaaaaaggtgtgacatgg
gatgtgattaaactgcagataaacatgtatacaacaccagttttacttagcgccttcctg
ggaattttaaatattattctgatccttgccatactaagagaacatcgtgtggatgactca
ggaagacagtgtaaaagtattaattttgaagaagcaagtacagatgaagctcaggttccc
caaggaaatattgaccaggttgctgttgtggccatcaatgttctgttttttgtgactcta
tttatctttgccctttttgaaaccatcattactccattaacaatggatatgtatgcctgg
actcaagaacaagctgtgttatataatggcataatacttgctgctcttggggttgaagcc
gttgttattttcttaggagttaagttgctttccaaaaagattggcgagcgtgctattcta
ctgggaggactcatcgttgtatgggttggcttctttatcttgttaccttggggaaatcaa
tttcccaaaatacagtgggaagatttgcacaataattcaatccctaataccacatttggg
gaaattattattggtctttggaagtctccaatggaagatgacaatgaaagaccaactggt
tgctcgattgaacaagcctggtgcctctacaccccggtgattcatctggcccagttcctt
acatcagctgtgctaataggattaggctatccagtctgcaatcttatgtcctatactcta
tattcaaaaattctaggaccaaaacctcagggtgtatacatgggctggttaacagcatct
ggaagtggagcccggattcttgggcctatgttcatcagccaagtgtatgctcactgggga
ccacgatgggcattcagcctggtgtgtggaataatagtgctcaccatcaccctcctggga
gtggtttacaaaagactcattgctctttctgtaagatatgggaggattcaggaataa

DBGET integrated database retrieval system