KEGG   Homo sapiens (human): 256949Help
Entry
256949            CDS       T01001                                 

Gene name
KANK3, ANKRD47
Definition
(RefSeq) KN motif and ankyrin repeat domains 3
  KO
K22808  KN motif and ankyrin repeat domain-containing protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    256949 (KANK3)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    256949 (KANK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank Ank_5 KN_motif Ank_4 Ank_3
Motif
Other DBs
NCBI-GeneID: 256949
NCBI-ProteinID: NP_940873
OMIM: 614611
HGNC: 24796
Ensembl: ENSG00000186994
Vega: OTTHUMG00000182461
Pharos: Q6NY19(Tdark)
UniProt: Q6NY19
Position
19p13.2
AA seq 821 aa AA seqDB search
MAKFALNQNLPDLGGPRLCPVPAAGGARSPSSPYSVETPYGFHLDLDFLKYIEELERGPA
ARRAPGPPTSRRPRAPRPGLAGARSPGAWTSSESLASDDGGAPGILSQGAPSGLLMQPLS
PRAPVRNPRVEHTLRETSRRLELAQTHERAPSPGRGVPRSPRGSGRSSPAPNLAPASPGP
AQLQLVREQMAAALRRLRELEDQARTLPELQEQVRALRAEKARLLAGRAQPEPDGEAETR
PDKLAQLRRLTERLATSERGGRARASPRADSPDGLAAGRSEGALQVLDGEVGSLDGTPQT
REVAAEAVPETREAGAQAVPETREAGVEAAPETVEADAWVTEALLGLPAAAERELELLRA
SLEHQRGVSELLRGRLRELEEAREAAEEAAAGARAQLREATTQTPWSCAEKAAQTESPAE
APSLTQESSPGSMDGDRAVAPAGILKSIMKKRDGTPGAQPSSGPKSLQFVGVLNGEYESS
SSEDASDSDGDSENGGAEPPGSSSGSGDDSGGGSDSGTPGPPSGGDIRDPEPEAEAEPQQ
VAQGRCELSPRLREACVALQRQLSRPRGVASDGGAVRLVAQEWFRVSSQRRSQAEPVARM
LEGVRRLGPELLAHVVNLADGNGNTALHYSVSHGNLAIASLLLDTGACEVNRQNRAGYSA
LMLAALTSVRQEEEDMAVVQRLFCMGDVNAKASQTGQTALMLAISHGRQDMVATLLACGA
DVNAQDADGATALMCASEYGRLDTVRLLLTQPGCDPAILDNEGTSALAIALEAEQDEVAA
LLHAHLSSGQPDTQSESPPGSQTATPGEGECGDNGENPQVQ
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atggccaagtttgccctgaatcagaacctgcccgacctgggcggcccccgcctgtgcccg
gtccccgccgccgggggcgcacgcagcccgagctcgccctactcggtggagacgccctac
ggcttccacctggacctggacttcctcaagtacatagaggagctggagcgtggccccgct
gcccgccgcgccccgggacccccgacctcgcgccgtccccgcgcgccccggcccggcctc
gcgggcgcacgtagcccaggcgcctggacatccagcgagtccctggccagtgacgacggt
ggagcaccgggcatactctcccagggcgcgccctcggggctcctgatgcagccgctgtcg
ccgcgcgcgcccgtgcgcaacccgcgcgtcgagcacacgctccgggagaccagccggcgg
ctggagctggcgcagacacacgagcgcgcgcccagccccggccgcggggtcccgcgcagc
ccacgcgggtccggccgcagcagccccgcccctaaccttgcccctgcttcgcccggccct
gcccaactgcagctggtgcgcgagcagatggccgcggcgctgcggcgcctgcgcgagctc
gaggaccaggcgcgaacgctgcccgagctgcaggagcaggtgcgcgcgctgcgcgccgag
aaggcgcggctgctggccgggcgcgcgcagcccgagccggacggggaggctgagacgcgc
ccggacaagctcgcccagctgcggcggctcaccgagcgcctggccacctccgagcgcggc
ggccgtgccagggccagcccccgggctgacagcccagacggcctggctgcagggcgcagc
gagggcgcgctccaggtcctcgacggggaggtcgggagtctcgatgggacgccccagacc
cgggaggtggccgccgaggccgtgcccgagacccgagaagcgggtgcccaggccgtgccg
gagacccgggaggccggcgtggaggctgcccccgagaccgtggaggcggacgcgtgggtg
accgaggcgctgctggggctgcctgcggccgccgagcgcgagctagagctgctgcgcgcc
agtctggagcaccagcgcggggtgagtgagcttctgcggggccggttgcgggagctggag
gaagcccgcgaggctgcggaggaggcagcggcgggggcccgggcccagctacgcgaggcc
accacccagaccccgtggagctgtgccgaaaaggccgcgcagaccgagtccccggcagag
gcgccctccttgactcaggagagctcgcccggatccatggacggagacagggccgtggcg
cccgcgggcatcctcaaatccatcatgaagaagagagacggcacacctggtgcccaaccc
agctccggacccaagagcctgcagtttgttggggtcctcaacggagagtacgagagctcc
tccagcgaggacgccagcgacagcgatggcgacagcgagaacggtggcgccgagcccccg
ggtagctcctcgggctccggggatgacagcggcgggggatccgactcgggcacccctggc
cctcccagcggcggggacatccgggaccctgagcccgaggcggaggcagagcctcagcag
gtggcacaggggaggtgcgagctgagcccgcgtctgagggaggcgtgcgtagcgctgcag
cggcagctgagccggccccgcggagtagccagcgacggcggcgcagtgcgcctcgtggcc
caggagtggtttcgagtgtccagccagcggcgctctcaggcggagcccgtggccaggatg
ctggaaggggtgaggcgcctgggacccgaactgctggcgcacgtggtgaacctggcggat
ggcaacgggaacacggccctgcactacagtgtgtcccacgggaacctggccatcgcaagc
ctgctcctggatacgggggcctgcgaggtcaaccgccagaaccgagccggctactcggcc
ctcatgctggctgcactcacctctgtgaggcaggaagaggaggacatggctgtggtccag
agactcttctgcatgggtgatgtcaatgccaaggccagtcagacggggcagacagccctc
atgctggccatcagccatggccgacaggacatggtggcaaccctactggcgtgtggggct
gatgtgaatgcgcaggatgcggatggggccacagcgctgatgtgtgccagtgagtatggg
cgcctggacaccgtgcggctgctgctcacccagccaggctgtgaccctgccatcctggac
aatgagggcaccagtgccctggccatcgccctggaggctgagcaggatgaggtggccgct
ctgctacatgcccacctgagctcgggccagcccgacacccagagcgagtcaccccctggc
tcccagacagccacacctggtgaaggagaatgcggtgacaatggagagaacccccaggtt
cagtaa

DBGET integrated database retrieval system