KEGG   Homo sapiens (human): 256979Help
Entry
256979            CDS       T01001                                 

Gene name
SUN3, SUNC1
Definition
(RefSeq) Sad1 and UNC84 domain containing 3
  KO
K21874  SUN domain-containing protein 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    256979 (SUN3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   LINC complex
    256979 (SUN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sad1_UNC DUF2730
Motif
Other DBs
NCBI-GeneID: 256979
NCBI-ProteinID: NP_001025190
HGNC: 22429
Ensembl: ENSG00000164744
Vega: OTTHUMG00000155646
Pharos: Q8TAQ9(Tdark)
UniProt: Q8TAQ9
Position
7p12.3
AA seq 357 aa AA seqDB search
MSGKTKARRAAMFFRRCSEDASGSASGNALLSEDENPDANGVTRSWKIILSTMLTLTFLL
VGLLNHQWLKETDVPQKSRQLYAIIAEYGSRLYKYQARLRMPKEQLELLKKESQNLENNF
RQILFLIEQIDVLKALLRDMKDGMDNNHNWNTHGDPVEDPDHTEEVSNLVNYVLKKLRED
QVEMADYALKSAGASIIEAGTSESYKNNKAKLYWHGIGFLNHEMPPDIILQPDVYPGKCW
AFPGSQGHTLIKLATKIIPTAVTMEHISEKVSPSGNISSAPKEFSVYGITKKCEGEEIFL
GQFIYNKTGTTVQTFELQHAVSEYLLCVKLNIFSNWGHPKYTCLYRFRVHGTPGKHI
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgagtggaaaaacaaaggcaagaagggctgccatgttttttagacgttgctctgaagac
gccagcggtagcgccagtggcaatgctttgttatcagaggacgaaaatcctgatgcgaat
ggggtaactcgatcatggaagattattctaagtacaatgcttacactgacttttcttctt
gtaggactcctaaatcatcagtggcttaaagaaacagatgttcctcagaaatccagacaa
ttatatgccataattgcagaatatggttcaaggctttataaatatcaggccagacttcgt
atgcctaaagagcaactggaacttttaaagaaggaaagccagaatctggaaaacaatttt
cgtcaaattctatttttgatcgaacaaatagatgtcctgaaggcattgctaagagatatg
aaggatggtatggacaataatcacaactggaacacccatggagaccctgtggaggacccg
gaccacacagaggaagtgtcaaacttggtcaattatgtacttaaaaagttgagagaagac
caagtcgagatggctgattatgccctgaagtcggccggagcctccatcattgaagctggg
acctcagaaagttataaaaataataaagcaaaattgtactggcatgggataggtttccta
aatcatgaaatgcctccagatattattcttcagccggatgtctaccctggaaagtgctgg
gcttttccaggttcccagggtcataccctaatcaagcttgctacaaagatcataccaact
gctgttaccatggagcacatctcagagaaggtgtctccgtcaggaaacatctccagtgca
cccaaggaattttctgtctatggcatcacaaaaaaatgtgaaggagaagaaattttccta
ggtcagtttatatataacaaaacaggaaccaccgttcaaacatttgaactccagcatgca
gtttctgaatatttattatgtgtgaaacttaatatctttagcaactggggacacccgaag
tatacttgtttatatcgattcagggtccatggcacaccaggcaagcacatctag

DBGET integrated database retrieval system