KEGG   Homo sapiens (human): 257106Help
Entry
257106            CDS       T01001                                 

Gene name
ARHGAP30
Definition
(RefSeq) Rho GTPase activating protein 30
  KO
K20645  Rho GTPase-activating protein 30
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    257106 (ARHGAP30)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    257106 (ARHGAP30)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGAP
Motif
Other DBs
NCBI-GeneID: 257106
NCBI-ProteinID: NP_001020769
OMIM: 614264
HGNC: 27414
Ensembl: ENSG00000186517
Vega: OTTHUMG00000031477
Pharos: Q7Z6I6(Tdark)
UniProt: Q7Z6I6
Position
1q23.3
AA seq 1101 aa AA seqDB search
MKSRQKGKKKGSAKERVFGCDLQEHLQHSGQEVPQVLKSCAEFVEEYGVVDGIYRLSGVS
SNIQKLRQEFESERKPDLRRDVYLQDIHCVSSLCKAYFRELPDPLLTYRLYDKFAEAVGV
QLEPERLVKILEVLRELPVPNYRTLEFLMRHLVHMASFSAQTNMHARNLAIVWAPNLLRS
KDIEASGFNGTAAFMEVRVQSIVVEFILTHVDQLFGGAALSGGEVESGWRSLPGTRASGS
PEDLMPRPLPYHLPSILQAGDGPPQMRPYHTIIEIAEHKRKGSLKVRKWRSIFNLGRSGH
ETKRKLPRGAEDREDKSNKGTLRPAKSMDSLSAAAGASDEPEGLVGPSSPRPSPLLPESL
ENDSIEAAEGEQEPEAEALGGTNSEPGTPRAGRSAIRAGGSSRAERCAGVHISDPYNVNL
PLHITSILSVPPNIISNVSLARLTRGLECPALQHRPSPASGPGPGPGLGPGPPDEKLEAS
PASSPLADSGPDDLAPALEDSLSQEVQDSFSFLEDSSSSEPEWVGAEDGEVAQAEAAGAA
FSPGEDDPGMGYLEELLGVGPQVEEFSVEPPLDDLSLDEAQFVLAPSCCSLDSAGPRPEV
EEENGEEVFLSAYDDLSPLLGPKPPIWKGSGSLEGEAAGCGRQALGQGGEEQACWEVGED
KQAEPGGRLDIREEAEGSPETKVEAGKASEDRGEAGGSQETKVRLREGSREETEAKEEKS
KGQKKADSMEAKGVEEPGGDEYTDEKEKEIEREEDEQREEAQVEAGRDLEQGAQEDQVAE
EKWEVVQKQEAEGVREDEDKGQREKGYHEARKDQGDGEDSRSPEAATEGGAGEVSKERES
GDGEAEGDQRAGGYYLEEDTLSEGSGVASLEVDCAKEGNPHSSEMEEVAPQPPQPEEMEP
EGQPSPDGCLCPCSLGLGGVGMRLASTLVQVQQVRSVPVVPPKPQFAKMPSAMCSKIHVA
PANPCPRPGRLDGTPGERAWGSRASRSSWRNGGSLSFDAAVALARDRQRTEAQGVRRTQT
CTEGGDYCLIPRTSPCSMISAHSPRPLSCLELPSEGAEGSGSRSRLSLPPREPQVPDPLL
SSQRRSYAFETQANPGKGEGL
NT seq 3306 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctcggcagaaaggaaagaagaagggcagcgcaaaggagcgggtttttgggtgc
gacttgcaggagcacctgcagcactcaggccaggaggtgccccaggtgctaaagagctgt
gcagaatttgtggaggagtatggagtggtggatgggatctaccgcctctcaggggtctcc
tccaacatccagaagcttcggcaggaatttgagtcagagcggaagccagacctgcgtcgg
gatgtttacctccaagacattcactgcgtctcctccctgtgcaaggcctatttcagagaa
ctgccggatcccctgctcacttaccggctctatgacaagtttgctgaggctgtaggagtg
caattggaacctgagcgcttggtcaagatcctagaggtgcttcgggaactccctgtccca
aactacaggaccctggagttcctcatgaggcacttggtacacatggcctcattcagtgcc
cagaccaacatgcatgctcgcaacctggccatcgtgtgggctcccaacctgctgaggtct
aaggacatagaggcctcaggcttcaatgggacagcggccttcatggaggtgcgggtacaa
tccatcgtcgtggagttcatcctcacacacgtggaccagctctttgggggtgctgccctc
tctggtggtgaggtggagagtgggtggcgatcgcttccagggacccgggcatcaggcagc
cccgaggaccttatgcccaggccactgccttatcacctgcctagcatactgcaggctggc
gatggacccccacagatgcggccctaccatactatcatcgagattgcagagcacaagagg
aaggggtctttgaaggtcaggaagtggaggtctatcttcaatttaggtcgctctggccat
gagactaagcgtaaacttccacggggggctgaggacagggaggataaatccaacaagggg
acactgcggccagccaaaagcatggactcactgagtgctgcagctggggccagtgatgag
ccagaggggctggtggggcccagcagcccccggccaagcccattgctgcctgagagcttg
gagaacgattctatagaggcagcagagggtgaacaggagcctgaggcagaagcactgggt
ggcacaaactctgaaccaggcacaccacgagctgggcggtcagccatccgggctgggggc
agcagccgtgcagaacgctgtgctggtgtccacatctcagacccctacaatgtcaacctc
ccgctacacatcacctctatcctcagtgtgcccccgaacatcatctctaacgtttccttg
gccaggctcacccgtggccttgagtgccctgctctacagcaccggccaagccctgcctct
ggccctggccctggccctggccttggccctggccccccagatgaaaagttggaagcaagt
ccagcctcaagtcccctggcagactcaggcccagacgacttggctcctgccctggaggac
tcgctgtcccaggaggtgcaggactccttctccttcctagaggactcaagcagctcagaa
cctgagtgggtgggggcagaggatggggaggtggcccaggcagaagcagcaggagcagcc
ttctcccctggggaggacgaccctgggatgggctacctggaggagctcctgggagttggg
cctcaggtggaggagttctctgtggagccacccctggatgacctgtctctggatgaggca
cagtttgtcttggcccccagctgctgttccctggactccgctggccccaggcctgaagtt
gaggaggaaaatggggaggaagttttcctgagtgcctatgatgacctaagtccccttctg
ggacctaaacccccaatctggaagggttcagggagtctggagggagaggcagcaggatgt
ggaaggcaggctctgggacagggtggggaagagcaggcatgctgggaagttggggaggac
aagcaggctgagcctggaggcaggctagacatcagggaagaggcagagggaagtccagag
accaaggtggaggctggaaaggccagtgaggatagaggggaggctgggggaagccaagag
acaaaagtcagattgagagaagggagtagggaagagacagaggccaaggaagagaagtcc
aaaggtcagaagaaggctgacagtatggaggctaaaggtgtggaggaaccaggaggagat
gagtatacagatgagaaggaaaaagaaattgagagagaagaggatgaacaaagagaggaa
gcccaggtagaagctggaagggacctagagcaaggggcccaggaagatcaagttgctgag
gagaaatgggaagttgtacagaaacaagaggctgagggagtcagagaggatgaggacaaa
ggacagagggagaaggggtaccatgaagcaagaaaagaccaaggagatggtgaagacagc
agaagcccagaagcagcaactgaaggaggagcaggggaggtcagcaaggaacgggagagt
ggggatggagaggctgagggagaccagagggctggagggtactatttagaagaggacacc
ctctctgaaggttcaggtgtagcgtccctggaggttgactgtgccaaagagggcaatcct
cactcttctgagatggaagaggtagccccacagccacctcagccagaggagatggagcct
gaggggcagcccagtccagacggctgtctatgcccctgttctcttggcctgggtggcgtg
ggcatgcgtctagcttccactctggttcaggtccaacaggtccgctctgtgcctgtggtg
ccccccaagccacagtttgccaagatgcccagtgcaatgtgtagcaagattcatgtggca
cctgcaaatccatgcccgaggcctggccggcttgatgggactcctggagaaagggcttgg
gggtcccgagcttctcgatcctcttggaggaatgggggtagtctttcctttgatgctgct
gtggccctagcccgggaccgccaaaggactgaggctcaaggagttcggcgaacccagacc
tgtactgagggtggggattactgcctcatccccagaacctccccttgtagcatgatctct
gcccattctcctcggccccttagctgcctggagctcccatctgaaggtgcagaagggtct
ggatcccggagtcgtcttagtctgccccccagagaaccccaggttcctgaccccctgttg
tcctctcagcgcaggtcatatgcatttgaaacacaggctaaccctgggaaaggtgaagga
ctgtga

DBGET integrated database retrieval system