KEGG   Homo sapiens (human): 257169
Entry
257169            CDS       T01001                                 
Symbol
C9orf43
Name
(RefSeq) chromosome 9 open reading frame 43
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF4647
Other DBs
NCBI-GeneID: 257169
NCBI-ProteinID: NP_001265558
HGNC: 23570
Ensembl: ENSG00000157653
Pharos: Q8TAL5(Tdark)
UniProt: Q8TAL5 A0A024R879 B2R9P8
Position
9:113410747..113429690
AA seq 461 aa
MDLPDESQWDETTCGLAVCQHPQCWATIRRIERGHPRILGSSCKTPLDAEDKLPVLTVVD
ILDSGFAAHHLPECTFTKAHSLLSQSSKFYSKFHGRPPKGLPDKSLINCTNRLPKFPVLN
LNETQLPCPEDVRNMVVLWIPEETEIHVSQHGKKKRKNSAVKSKSFLGLSGNQSAGTRVG
TPGMIVPPPTPVQLSEQFSSDFLPLWAQSEALPQDLLKELLPGGKQTMLCPEMKIKLAMM
KKNLPLEKNRPDSVISSKMFLSIHRLTLERPALRYPERLKKLHNLKTEGYRKQQQRQQQQ
QQQQKKVKTPIKKQEAKKKAKSDPGIQSTSHKHPVTTVHDRLYGYRTLPGQNSDMKQQQQ
MEKGTTSKQDSTERPKMNYYDHADFHHSVKSPELYETEPTNKDISAPVDAVPEAQAARQK
KISFNFSEIMASTGWNSELKLLRILQDTDDEDEEDQSSGAE
NT seq 1386 nt   +upstreamnt  +downstreamnt
atggacttgccagatgagagccagtgggacgaaaccacctgtggcttggctgtttgtcag
cacccacaatgctgggcaactatccgccgcattgagaggggccatcctcgaatcctcggc
tcatcctgcaaaactcccctggatgctgaagataaactcccagtgctcaccgtggtagac
atcttagattccggctttgcagctcatcatttaccagaatgtacctttactaaggcccat
tctttattgtctcagagttcaaagttttactccaaatttcatggcaggcctccgaagggt
ttacctgacaaaagtttgatcaactgtactaacagacttcccaaatttccagtgttgaat
ttgaatgagacgcaacttccctgccctgaagatgttagaaatatggttgtattgtggatc
ccagaagaaacagagatacatgtgagccagcatgggaagaagaaaagaaagaactcggca
gtgaaaagcaagtcatttctgggtctctctggaaatcagtccgcaggaacacgagtagga
acaccagggatgatcgtgcctcccccaaccccagtgcaattgtctgaacaattcagttca
gatttcctacctctctgggctcaatccgaagcgttacctcaggatctactgaaggaactt
ttgccaggtggaaagcaaaccatgctctgtccagagatgaagataaaattggccatgatg
aaaaagaatcttcccttggaaaagaaccgacctgacagtgtgatttcttctaagatgttt
ctatctatacaccgcctcaccctggaaagaccagcactgcgatatcctgaacgtttgaag
aaattacataacctgaagacagaaggttacaggaaacagcagcagcggcagcagcagcag
cagcagcaacagaagaaggtgaaaacacctattaagaaacaggaggctaaaaagaaagcc
aagagtgatccagggatccagagcacttcacataaacatccagttaccaccgttcatgac
cgtctctatggttacagaactctgccaggtcagaacagtgacatgaagcagcagcagcag
atggaaaaaggaaccacttcgaaacaggattccacggagagaccaaagatgaactactat
gaccatgcggatttccaccacagtgtaaaaagtcctgaattgtatgaaacagaacccact
aacaaggacattagtgctccagtggacgctgtgccagaagcccaggctgccaggcaaaag
aagatctcctttaacttttcagaaattatggctagcacaggctggaactctgagctcaaa
ctacttaggattcttcaggacactgatgatgaggatgaggaggaccagtcctctggggca
gagtga

DBGET integrated database retrieval system