KEGG   Homo sapiens (human): 2572Help
Entry
2572              CDS       T01001                                 

Gene name
GAD2, GAD65
Definition
(RefSeq) glutamate decarboxylase 2
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00250  Alanine, aspartate and glutamate metabolism
hsa00410  beta-Alanine metabolism
hsa00430  Taurine and hypotaurine metabolism
hsa00650  Butanoate metabolism
hsa01100  Metabolic pathways
hsa04727  GABAergic synapse
hsa04940  Type I diabetes mellitus
Module
hsa_M00027  GABA (gamma-Aminobutyrate) shunt
Drug target
Valproic acid (DG00849): D00304 D00399 D00710 D08667
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    2572 (GAD2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    2572 (GAD2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    2572 (GAD2)
   00430 Taurine and hypotaurine metabolism
    2572 (GAD2)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    2572 (GAD2)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    2572 (GAD2)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     2572 (GAD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 2572
NCBI-ProteinID: NP_000809
OMIM: 138275
HGNC: 4093
Ensembl: ENSG00000136750
Vega: OTTHUMG00000017836
Pharos: Q05329(Tbio)
UniProt: Q05329 Q5VZ30
Structure
PDB: 

Position
10p12.1
AA seq 585 aa AA seqDB search
MASPGSGFWSFGSEDGSGDSENPGTARAWCQVAQKFTGGIGNKLCALLYGDAEKPAESGG
SQPPRAAARKAACACDQKPCSCSKVDVNYAFLHATDLLPACDGERPTLAFLQDVMNILLQ
YVVKSFDRSTKVIDFHYPNELLQEYNWELADQPQNLEEILMHCQTTLKYAIKTGHPRYFN
QLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWPGGSGDGIFS
PGGAISNMYAMMIARFKMFPEVKEKGMAALPRLIAFTSEHSHFSLKKGAAALGIGTDSVI
LIKCDERGKMIPSDLERRILEAKQKGFVPFLVSATAGTTVYGAFDPLLAVADICKKYKIW
MHVDAAWGGGLLMSRKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQNCNQ
MHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAHVDKCLELAEY
LYNIIKNREGYEMVFDGKPQHTNVCFWYIPPSLRTLEDNEERMSRLSKVAPVIKARMMEY
GTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggcatctccgggctctggcttttggtctttcgggtcggaagatggctctggggattcc
gagaatcccggcacagcgcgagcctggtgccaagtggctcagaagttcacgggcggcatc
ggaaacaaactgtgcgccctgctctacggagacgccgagaagccggcggagagcggcggg
agccaacccccgcgggccgccgcccggaaggccgcctgcgcctgcgaccagaagccctgc
agctgctccaaagtggatgtcaactacgcgtttctccatgcaacagacctgctgccggcg
tgtgatggagaaaggcccactttggcgtttctgcaagatgttatgaacattttacttcag
tatgtggtgaaaagtttcgatagatcaaccaaagtgattgatttccattatcctaatgag
cttctccaagaatataattgggaattggcagaccaaccacaaaatttggaggaaattttg
atgcattgccaaacaactctaaaatatgcaattaaaacagggcatcctagatacttcaat
caactttctactggtttggatatggttggattagcagcagactggctgacatcaacagca
aatactaacatgttcacctatgaaattgctccagtatttgtgcttttggaatatgtcaca
ctaaagaaaatgagagaaatcattggctggccagggggctctggcgatgggatattttct
cccggtggcgccatatctaacatgtatgccatgatgatcgcacgctttaagatgttccca
gaagtcaaggagaaaggaatggctgctcttcccaggctcattgccttcacgtctgaacat
agtcatttttctctcaagaagggagctgcagccttagggattggaacagacagcgtgatt
ctgattaaatgtgatgagagagggaaaatgattccatctgatcttgaaagaaggattctt
gaagccaaacagaaagggtttgttcctttcctcgtgagtgccacagctggaaccaccgtg
tacggagcatttgaccccctcttagctgtcgctgacatttgcaaaaagtataagatctgg
atgcatgtggatgcagcttggggtgggggattactgatgtcccgaaaacacaagtggaaa
ctgagtggcgtggagagggccaactctgtgacgtggaatccacacaagatgatgggagtc
cctttgcagtgctctgctctcctggttagagaagagggattgatgcagaattgcaaccaa
atgcatgcctcctacctctttcagcaagataaacattatgacctgtcctatgacactgga
gacaaggccttacagtgcggacgccacgttgatgtttttaaactatggctgatgtggagg
gcaaaggggactaccgggtttgaagcgcatgttgataaatgtttggagttggcagagtat
ttatacaacatcataaaaaaccgagaaggatatgagatggtgtttgatgggaagcctcag
cacacaaatgtctgcttctggtacattcctccaagcttgcgtactctggaagacaatgaa
gagagaatgagtcgcctctcgaaggtggctccagtgattaaagccagaatgatggagtat
ggaaccacaatggtcagctaccaacccttgggagacaaggtcaatttcttccgcatggtc
atctcaaacccagcggcaactcaccaagacattgacttcctgattgaagaaatagaacgc
cttggacaagatttataa

DBGET integrated database retrieval system