KEGG   Homo sapiens (human): 257202Help
Entry
257202            CDS       T01001                                 

Gene name
GPX6, GPX5p, GPXP3, GPx-6, GSHPx-6, dJ1186N24, dJ1186N24.1
Definition
(RefSeq) glutathione peroxidase 6
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00590  Arachidonic acid metabolism
hsa04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    257202 (GPX6)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    257202 (GPX6)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    257202 (GPX6)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     257202 (GPX6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 257202
NCBI-ProteinID: NP_874360
OMIM: 607913
HGNC: 4558
Ensembl: ENSG00000198704
Vega: OTTHUMG00000044828
Pharos: P59796(Tdark)
UniProt: P59796
Position
6p22.1
AA seq 221 aa AA seqDB search
MFQQFQASCLVLFFLVGFAQQTLKPQNRKVDCNKGVTGTIYEYGALTLNGEEYIQFKQFA
GKHVLFVNVAAYUGLAAQYPELNALQEELKNFGVIVLAFPCNQFGKQEPGTNSEILLGLK
YVCPGSGFVPSFQLFEKGDVNGEKEQKVFTFLKNSCPPTSDLLGSSSQLFWEPMKVHDIR
WNFEKFLVGPDGVPVMHWFHQAPVSTVKSDILEYLKQFNTH
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgttccagcagttccaggcctcctgtcttgtcctgtttttcctggttggctttgctcag
cagaccctaaagcctcaaaataggaaggtggattgcaacaaaggggtaacaggcaccatc
tatgagtatggagccctcaccctcaacggcgaggagtacatccaattcaagcagtttgca
ggcaagcacgtcctgtttgtcaatgtggccgcctattgaggcttggcagctcagtatcct
gaactgaatgcactacaggaggagctgaagaattttggtgtcattgtgttggcctttccc
tgcaaccagtttggaaaacaagaaccaggaacaaactcagaaatacttcttggtctcaag
tatgtgtgtccaggtagtggctttgtccccagtttccagctctttgagaaaggggatgtg
aatggagaaaaagaacagaaggtctttactttcctgaagaactcctgccctccgacctct
gatcttttgggctcatcaagccaactcttctgggagcccatgaaggtccatgatatccgc
tggaactttgagaaatttctggtggggcccgatggagtccctgtcatgcattggttccac
caggctccagtcagcacagtcaagtcagacatcctggagtacctaaagcagttcaatacc
cactag

DBGET integrated database retrieval system