KEGG   Homo sapiens (human): 257397
Entry
257397            CDS       T01001                                 

Gene name
TAB3, MAP3K7IP3, NAP1
Definition
(RefSeq) TGF-beta activated kinase 1 (MAP3K7) binding protein 3
  KO
K12793  TAK1-binding protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
Network
nt06110  MAPK signaling (viruses and bacteria)
nt06123  TNF signaling (viruses and bacteria)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06211  Other MAPK signaling
nt06223  TNF signaling
nt06263  Hepatocellular carcinoma
  Element
N00151  TNF-NFKB signaling pathway
N00186  IL1-IL1R-p38 signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
N00441  HIV gp120 to TNF-NFKB signaling pathway
N00442  HIV Nef to TNF-NFKB signaling pathway
N00927  Escherichia/Shigella NleE/OspZ to TNF-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    257397 (TAB3)
   04668 TNF signaling pathway
    257397 (TAB3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    257397 (TAB3)
   04657 IL-17 signaling pathway
    257397 (TAB3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    257397 (TAB3)
   05132 Salmonella infection
    257397 (TAB3)
   05131 Shigellosis
    257397 (TAB3)
SSDB
Motif
Pfam: CUE zf-RanBP Tmemb_cc2
Other DBs
NCBI-GeneID: 257397
NCBI-ProteinID: NP_690000
OMIM: 300480
HGNC: 30681
Ensembl: ENSG00000157625
Vega: OTTHUMG00000021329
Pharos: Q8N5C8(Tbio)
UniProt: Q8N5C8
Position
Xp21.2
AA seq 712 aa
MAQSSPQLDIQVLHDLRQRFPEIPEGVVSQCMLQNNNNLEACCRALSQESSKYLYMEYHS
PDDNRMNRNRLLHINLGIHSPSSYHPGDGAQLNGGRTLVHSSSDGHIDPQHAAGKQLICL
VQEPHSAPAVVAATPNYNPFFMNEQNRSAATPPSQPPQQPSSMQTGMNPSAMQGPSPPPP
PPSYMHIPRYSTNPITVTVSQNLPSGQTVPRALQILPQIPSNLYGSPGSIYIRQTSQSSS
GRQTPQSTPWQSSPQGPVPHYSQRPLPVYPHQQNYQPSQYSPKQQQIPQSAYHSPPPSQC
PSPFSSPQHQVQPSQLGHIFMPPSPSTTPPHPYQQGPPSYQKQGSHSVAYLPYTASSLSK
GSMKKIEITVEPSQRPGTAINRSPSPISNQPSPRNQHSLYTATTPPSSSPSRGISSQPKP
PFSVNPVYITYTQPTGPSCTPSPSPRVIPNPTTVFKITVGRATTENLLNLVDQEERSAAP
EPIQPISVIPGSGGEKGSHKYQRSSSSGSDDYAYTQALLLHQRARMERLAKQLKLEKEEL
ERLKSEVNGMEHDLMQRRLRRVSCTTAIPTPEEMTRLRSMNRQLQINVDCTLKEVDLLQS
RGNFDPKAMNNFYDNIEPGPVVPPKPSKKDSSDPCTIERKARRISVTSKVQADIHDTQAA
AADEHRTGSTQSPRTQPRDEDYEGAPWNCDSCTFLNHPALNRCEQCEMPRYT
NT seq 2139 nt   +upstreamnt  +downstreamnt
atggcgcaaagcagcccacagcttgatattcaggttctccatgatcttcgacaacgtttc
cctgaaattccagagggcgtggtgtctcagtgcatgttacagaataacaacaatcttgaa
gcctgttgccgagccctttcccaggagagtagcaaatacttatatatggaataccatagt
ccagatgacaataggatgaatagaaatcgccttttacatattaacctgggtatccattct
cctagtagctatcacccaggagatggagcccaacttaatggtggtcgaacactggtacat
agctcaagtgatggacatattgatcctcagcatgcagcaggtaaacagctgatatgttta
gttcaagaaccacactcagctccagctgttgttgctgctactcccaactacaatccattt
tttatgaacgaacagaacagaagtgcagctactcctccttcacaaccacctcaacagcca
tcttccatgcaaacaggaatgaatccgtctgctatgcaagggccttcaccaccaccgcca
cctccttcatacatgcacatacctcggtatagtacaaatccaattactgttacagtatcc
cagaacctcccttctggacagactgtaccaagagctttacaaattcttccacaaattcca
agcaatctctatgggtctcctggttctatttatattagacagacatctcagagttcatca
ggaagacaaactcctcagagtacgccgtggcagtcctcaccacagggcccagtgcctcac
tatagccagcgtcctttacctgtttatccacaccaacagaactatcagccttctcagtat
tctcccaaacagcagcagatccctcagtctgcttaccattcaccacctccttctcaatgt
ccttcacccttcagctctccacagcatcaagtgcaaccttcccagttgggccacatcttt
atgccacctagtccttcaactactccaccccatccatatcaacaaggacctcctagctat
cagaaacagggaagccattcagtagcctatcttccatacacagcatctagtttatccaaa
ggttccatgaagaagatagaaattacagttgaaccttctcaaagacctgggacagcaatt
aataggagtccttcacccatcagtaatcaaccatctccacggaatcaacactcactgtac
acagccaccacgccaccttcaagttctccttcaagagggatatctagtcaaccaaaacct
ccatttagtgttaatcctgtgtatattacatatacacagccaactggaccttcttgtact
ccatcaccatctcctcgagtgataccaaacccaactacagtttttaaaattaccgtaggc
cgagcaacgactgaaaatcttttaaatttagtggaccaagaagagcgctctgcagcacca
gaacctattcagcccatttcagtgataccaggctctgggggagaaaagggaagccataaa
tatcagagaagttctagttctggatcagatgactatgcctacacacaagccttgctgtta
catcaacgagcaaggatggagaggttagcaaagcaactgaaacttgagaaagaggagcta
gagcggttgaagtctgaagttaatggtatggagcatgacctgatgcagagacggctcaga
agagtcagctgcaccactgcgatccctacgcctgaggaaatgacaagattgagaagcatg
aacagacaactccagataaatgttgactgtacactgaaagaagttgacctccttcaatct
agaggaaactttgatccaaaagccatgaataatttttatgacaacatagaacctggccca
gttgtaccacccaagccatctaaaaaagactcctcagacccctgcacaattgagagaaaa
gcccgaagaattagcgtgacctccaaagtacaggcagacatccatgacacccaggcagca
gctgcagatgagcatcgaactggctccacacaaagtcctcggacacaacctcgagatgaa
gactacgaaggggctccatggaattgtgatagctgcacctttcttaaccacccagcacta
aatcgctgtgagcagtgcgagatgccacggtacacctga

DBGET integrated database retrieval system