KEGG   Homo sapiens (human): 25769Help
Entry
25769             CDS       T01001                                 

Gene name
SLC24A2, NCKX2
Definition
(RefSeq) solute carrier family 24 member 2
  KO
K13750  solute carrier family 24 (sodium/potassium/calcium exchanger), member 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    25769 (SLC24A2)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC24: Na+/(Ca2+-K+) exchanger
   25769 (SLC24A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Na_Ca_ex
Motif
Other DBs
NCBI-GeneID: 25769
NCBI-ProteinID: NP_065077
OMIM: 609838
HGNC: 10976
Ensembl: ENSG00000155886
Vega: OTTHUMG00000019646
Pharos: Q9UI40(Tbio)
UniProt: Q9UI40
Position
9p22.1-p21.3
AA seq 661 aa AA seqDB search
MDLQQSTTITSLEKWCLDESLSGCRRHYSVKKKLKLIRVLGLFMGLVAISTVSFSISAFS
ETDTQSTGEASVVSGPRVAQGYHQRTLLDLNDKILDYTPQPPLSKEGESENSTDHAQGDY
PKDIFSLEERRKGAIILHVIGMIYMFIALAIVCDEFFVPSLTVITEKLGISDDVAGATFM
AAGGSAPELFTSLIGVFIAHSNVGIGTIVGSAVFNILFVIGMCALFSREILNLTWWPLFR
DVSFYIVDLIMLIIFFLDNVIMWWESLLLLTAYFCYVVFMKFNVQVEKWVKQMINRNKVV
KVTAPEAQAKPSAARDKDEPTLPAKPRLQRGGSSASLHNSLMRNSIFQLMIHTLDPLAEE
LGSYGKLKYYDTMTEEGRFREKASILHKIAKKKCHVDENERQNGAANHVEKIELPNSTST
DVEMTPSSDASEPVQNGNLSHNIEGAEAQTADEEEDQPLSLAWPSETRKQVTFLIVFPIV
FPLWITLPDVRKPSSRKFFPITFFGSITWIAVFSYLMVWWAHQVGETIGISEEIMGLTIL
AAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITVGLPLPWLLYTVIHRFQPVAVSS
NGLFCAIVLLFIMLLFVILSIALCKWRMNKILGFIMFGLYFVFLVVSVLLEDRILTCPVS
I
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atggatctgcaacaaagcaccaccatcacttccctagagaaatggtgtttggatgagtca
ctgtctggctgcagaagacattatagtgtcaagaaaaaactgaagttaattcgagtctta
ggccttttcatgggtctggtagccattagcactgtctcattttcaatcagtgccttttct
gagacagatacacagagcacaggagaggccagtgttgtaagtggccctagggtagcacag
ggttaccatcagagaactctcttagatttaaatgacaagattctggattatactccacag
ccacctctttctaaggaaggcgagtctgagaatagtacagatcacgcccaaggagactac
ccgaaagacatcttttcccttgaggagagaagaaaaggtgcgatcattctgcatgtcatt
ggaatgatctacatgttcatagccttagccattgtctgtgatgagttctttgttccttct
ttgactgtcatcactgaaaaactgggcatctctgatgatgtggctggagccaccttcatg
gctgcaggagggtcagccccagaacttttcacatctctcataggggtatttatcgctcac
agcaacgttggcataggcacaattgtaggttcagcagtattcaacatcctctttgttatt
ggcatgtgtgctctgttttctagagaaatcttaaacctgacatggtggccgctctttcga
gatgtgtctttctacattgttgacttgatcatgctgatcatatttttcctggataatgtc
atcatgtggtgggaaagcttgcttctcttaacagcttatttttgctatgtggttttcatg
aaattcaacgtccaagtagaaaaatgggtgaagcaaatgataaaccgcaataaggtcgtc
aaggtgacagcaccagaagcccaagcaaagccatctgcagccagggacaaggatgaacca
actctaccggctaagccgcgtctccagcgaggtggaagctctgcctccctccacaacagt
ctcatgaggaatagcatcttccaactcatgatacacacccttgacccactcgccgaagaa
cttggatcatatggaaaactaaaatattatgacacaatgactgaagaagggaggttcaga
gaaaaggcttcaattctccacaagatcgccaagaagaaatgtcatgtggatgagaacgag
aggcagaatggggctgccaaccacgtggaaaaaattgagcttccaaacagcaccagcaca
gatgttgaaatgacaccatccagtgatgcttcagaacctgtacaaaatggaaatctctcc
cacaacattgaaggtgcagaagcccagaccgctgatgaggaggaggaccagcctctcagc
cttgcctggccttctgaaacccgcaagcaagtcacgtttctgattgttttccccatagtg
tttcctctctggattacgttacctgacgttcgcaaaccttcatcgaggaagttttttccc
atcacgttctttggctccattacctggattgcagtattctcttacttgatggtctggtgg
gcgcaccaggttggagagacaattggcatcagtgaagagattatgggcctgaccatcttg
gctgctgggacctccatccctgatcttatcaccagtgtcatagtggcccggaaggggtta
ggggacatggctgtgtccagctctgttggaagcaacatttttgacatcactgtagggctc
ccactgccctggctcctgtacaccgtcattcacagattccagccagtggctgtcagcagc
aatggccttttctgtgccatcgtccttctcttcatcatgctgctcttcgtcatcctctct
atcgccctctgcaagtggcgaatgaacaaaatcctgggcttcatcatgtttggcctctac
tttgtgttcctggtggtgagcgttctcctagaagacagaattcttacatgccccgtctcc
atctag

DBGET integrated database retrieval system