KEGG   Homo sapiens (human): 25778Help
Entry
25778             CDS       T01001                                 

Gene name
DSTYK, CAKUT1, DustyPK, HDCMD38P, RIP5, RIPK5, SPG23
Definition
(RefSeq) dual serine/threonine and tyrosine protein kinase
  KO
K16288  dual serine/threonine and tyrosine protein kinase [EC:2.7.12.1]
Organism
hsa  Homo sapiens (human)
Disease
H00266  Hereditary spastic paraplegia
H01867  Congenital anomalies of kidney and urinary tract
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     25778 (DSTYK)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  Other
   25778 (DSTYK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Pkinase_fungal Haspin_kinase Kdo Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 25778
NCBI-ProteinID: NP_056190
OMIM: 270750 612666
HGNC: 29043
Ensembl: ENSG00000133059
Vega: OTTHUMG00000037102
Pharos: Q6XUX3(Tbio)
UniProt: Q6XUX3
Position
1q32.1
AA seq 929 aa AA seqDB search
MEGDGVPWGSEPVSGPGPGGGGMIRELCRGFGRYRRYLGRLRQNLRETQKFFRDIKCSHN
HTCLSSLTGGGGAERGPAGDVAETGLQAGQLSCISFPPKEEKYLQQIVDCLPCILILGQD
CNVKCQLLNLLLGVQVLPTTKLGSEESCKLRRLRFTYGTQTRVSLALPGQYELVHTLVAH
QGNWETIPEEDLEVQENNEDAAHVLAELEVTMHHALLQEVDVVVAPCQGLRPTVDVLGDL
VNDFLPVITYALHKDELSERDEQELQEIRKYFSFPVFFFKVPKLGSEIIDSSTRRMESER
SPLYRQLIDLGYLSSSHWNCGAPGQDTKAQSMLVEQSEKLRHLSTFSHQVLQTRLVDAAK
ALNLVHCHCLDIFINQAFDMQRDLQITPKRLEYTRKKENELYESLMNIANRKQEEMKDMI
VETLNTMKEELLDDATNMEFKDVIVPENGEPVGTREIKCCIRQIQELIISRLNQAVANKL
ISSVDYLRESFVGTLERCLQSLEKSQDVSVHITSNYLKQILNAAYHVEVTFHSGSSVTRM
LWEQIKQIIQRITWVSPPAITLEWKRKVAQEAIESLSASKLAKSICSQFRTRLNSSHEAF
AASLRQLEAGHSGRLEKTEDLWLRVRKDHAPRLARLSLESCSLQDVLLHRKPKLGQELGR
GQYGVVYLCDNWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHGSVIDY
NYGGGSSIAVLLIMERLHRDLYTGLKAGLTLETRLQIALDVVEGIRFLHSQGLVHRDIKL
KNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELFTGKYDNSVDVYAFGILFWY
ICSGSVKLPEAFERCASKDHLWNNVRRGARPERLPVFDEECWQLMEACWDGDPLKRPLLG
IVQPMLQGIMNRLCKSNSEQPNRGLDDST
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atggagggcgacggggtgccatggggcagcgagcccgtctcgggtcccggccccggcggc
ggcggaatgatccgcgagctgtgccggggcttcggccgctaccgccgctacctgggacgg
ctgcgacagaacctgcgcgagacccagaagttcttccgcgacatcaagtgctcccacaac
cacacttgtctctcctccctcacgggcggcggcggggccgagcgcggccctgcaggcgat
gtcgccgaaaccgggctgcaggcgggccaactgagctgcatttccttcccacctaaggaa
gagaagtacctccagcagattgtggactgcctcccttgcatactgatcctcggccaggat
tgtaacgtcaagtgccagctgttgaatctgctgttgggggtgcaggtgcttcccaccacc
aagctgggcagtgaggagagctgtaagcttcggcgcctccgcttcacctatgggactcag
actcgggtcagcctggcgctccctggacagtatgaactagtgcacacgctggttgctcat
cagggcaactgggagaccatccctgaggaggatctggaggtccaagagaacaatgaggat
gctgctcatgttttagcggaactggaggtaacgatgcaccatgctctcttacaggaagtg
gacgttgtggtagcaccatgccaaggcctccggcccacagtggatgttctgggtgacttg
gtgaatgatttcttgcctgtgataacctatgcactccacaaagatgaactctctgagagg
gatgagcaagagcttcaggaaatccgaaagtatttctcctttcctgtattctttttcaaa
gtgccgaaactgggctcggagataatagactcctcaaccaggagaatggagagcgaaaga
tcaccgctttatcgccagctaattgacctgggctatctgagcagcagtcactggaactgt
ggggctcctggccaggatactaaagctcagagcatgttggtggaacagagtgaaaagctg
agacacttgagcacattttctcaccaggtgttacagactcgcctggtggatgcagccaag
gccctgaacctggtgcactgccactgccttgacatctttattaaccaggcatttgacatg
cagcgggacctgcagatcactcccaaacgtctggaatatactcgaaaaaaggagaatgag
ttgtatgaatcattgatgaatattgccaaccgaaagcaggaggaaatgaaggatatgatt
gttgagacacttaataccatgaaggaggaacttctggatgatgctactaacatggagttt
aaagacgtcattgtccctgagaatggagaaccagtaggcaccagagagatcaaatgctgc
atccgacagatccaggaactcatcatctcccgacttaatcaggcagtggctaataagctg
atcagctcagtggattacctgagggaaagcttcgtcggaaccctggaacgatgtctgcag
agcctggagaagtctcaggatgtctcagttcacatcaccagtaattatctcaaacagatc
ttaaatgctgcctatcatgttgaagtcacgtttcactcagggtcgtcagttacaaggatg
ctatgggagcaaatcaaacagatcatccagcgcatcacatgggtgagcccacctgccatc
actctggaatggaagaggaaggtggcccaggaagccattgagagcctcagcgcctccaaa
ttggctaagagcatttgcagccaattccggactcggctcaatagttcccacgaggctttt
gcagcctccttgcggcagctggaagctggccactcaggccggttagagaaaacggaagat
ctatggctgagggttcggaaagatcatgctccccgcctggcccgcctttctctggaaagc
tgttctttacaggatgtcttgcttcatcgtaaacctaaactgggacaggaactgggccgg
ggccagtatggtgtggtatacctgtgtgacaactggggaggacacttcccttgtgccctc
aaatcagttgtccctccagatgagaagcactggaatgatctggctttggaatttcactat
atgaggtctctgccgaagcatgagcgattggtggatctccatggttcagtcattgactac
aactatggtggtggctccagcattgctgtgctcctcattatggagcggctacaccgggat
ctctacacagggctgaaggctgggctgaccctggagacacgtttgcagatagcactagat
gtggtggagggaatccgcttcctgcacagccagggacttgtccatcgtgatatcaaactg
aaaaatgtgctgctggataagcagaaccgtgccaagatcactgacttaggattctgcaag
ccagaggccatgatgtcaggcagcattgtggggacaccaatccatatggcccctgaactt
ttcacagggaagtacgataattccgtggatgtctacgcttttggaattcttttctggtat
atctgctcaggctctgtcaagctccctgaggcatttgagaggtgtgctagcaaagaccat
ctctggaacaatgtgcggaggggggctcgcccagaacgtcttcctgtgtttgatgaggag
tgctggcagttgatggaagcctgttgggatggcgaccccttgaagaggcctctcttgggc
attgtccagcccatgctccagggcatcatgaatcggctctgcaagtccaattctgagcag
ccaaacagaggactagatgattctacttga

DBGET integrated database retrieval system