KEGG   Homo sapiens (human): 25780Help
Entry
25780             CDS       T01001                                 

Gene name
RASGRP3, GRP3
Definition
(RefSeq) RAS guanyl releasing protein 3
  KO
K12362  RAS guanyl-releasing protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04662  B cell receptor signaling pathway
hsa05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    25780 (RASGRP3)
   04015 Rap1 signaling pathway
    25780 (RASGRP3)
   04010 MAPK signaling pathway
    25780 (RASGRP3)
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    25780 (RASGRP3)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    25780 (RASGRP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF C1_1 EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 RasGEF_N
Motif
Other DBs
NCBI-GeneID: 25780
NCBI-ProteinID: NP_001132960
OMIM: 609531
HGNC: 14545
Ensembl: ENSG00000152689
Vega: OTTHUMG00000152124
Pharos: Q8IV61(Tchem)
UniProt: Q8IV61
Position
2p22.3
AA seq 690 aa AA seqDB search
MGSSGLGKAATLDELLCTCIEMFDDNGELDNSYLPRIVLLMHRWYLSSTELAEKLLCMYR
NATGESCNEFRLKICYFMRYWILKFPAEFNLDLGLIRMTEEFREVASQLGYEKHVSLIDI
SSIPSYDWMRRVTQRKKVSKKGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDYQSYV
IHGCLENNPTLERSIALFNGISKWVQLMVLSKPTPQQRAEVITKFINVAKKLLQLKNFNT
LMAVVGGLSHSSISRLKETHSHLSSEVTKNWNEMTELVSSNGNYCNYRKAFADCDGFKIP
ILGVHLKDLIAVHVIFPDWTEENKVNIVKMHQLSVTLSELVSLQNASHHLEPNMDLINLL
TLSLDLYHTEDDIYKLSLVLEPRNSKSQPTSPTTPNKPVVPLEWALGVMPKPDPTVINKH
IRKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAYFLR
AKSQLHCKMGPGFIHNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLL
VLACRRFARAPSLSSGHGSLPGSPSLPPAQDEVFEFPGVTAGHRDLDSRAITLVTGSSRK
ISVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPRV
HAGVDVVDRGTEFELDQDEGEETRQDGEDG
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgggatcaagtggccttgggaaagcagcaacattagatgaactgctgtgcacttgcatt
gagatgtttgatgacaatggagagctggataatagttatttgccaagaatagttctactg
atgcaccgatggtatttatcttccactgaattggcagaaaaacttctctgcatgtatcga
aatgccactggagaaagctgcaatgaatttcgattaaagatctgctacttcatgaggtac
tggattctgaagtttcctgcagagtttaatttggatcttggtttgattcgtatgactgag
gaatttcgggaagtagctagtcaactaggatatgaaaaacacgtcagcctcatcgacata
tccagcattccttcctatgactggatgagaagagtcacacagaggaaaaaagtatccaag
aagggaaaagcctgtctgctgtttgaccatctggagcccattgaattggctgagcacctc
acttttctggagcataaatcttttagaaggatctcattcactgattaccaaagctatgtc
atccatggctgcctggagaataatccaaccttggaaagatcgattgctttatttaatgga
atctctaagtgggtccagttgatggttcttagcaaaccaaccccccagcaaagggcagaa
gtcatcacaaagtttatcaatgttgcaaagaagctccttcagctcaaaaattttaacacc
ctgatggcagtggtgggaggcctcagtcatagttccatttcacgcctcaaagagacccat
tctcatctttcttcagaagttacaaagaactggaatgaaatgacagagttggtctcctcc
aacggcaattactgcaattaccgcaaggcctttgccgactgcgatggcttcaaaatcccc
atccttggagtacacttgaaagacttgatagctgtccatgtcattttcccagactggaca
gaggagaacaaagtgaacattgtgaaaatgcaccagctctccgttaccctgagtgaacta
gtctccctgcagaatgcctctcaccacttagaacccaacatggatttgatcaacctgctc
acgctttccctggacctctatcacactgaagatgatatttacaaactgtcactggtgctg
gagcctagaaattctaaatcgcagcctacctcccctacgacgcccaacaagcctgtggta
cccctggagtgggcattaggggtgatgccaaagccagaccccacggtcatcaacaagcac
ataaggaaattagtggagtctgtatttagaaactatgatcacgaccatgatgggtacatt
tcccaagaggactttgaaagtatagctgccaattttcccttcttggattccttctgtgtt
ctggacaaagatcaggatggcctaattagtaaagatgaaatgatggcttacttcctgaga
gctaaatcccaactacactgtaaaatgggaccaggatttatccataattttcaggagatg
acctatctcaagccaaccttctgcgaacactgtgcgggatttctctggggcataatcaag
caaggatacaaatgcaaagactgtggagccaattgtcacaaacagtgcaaagacctcctg
gttctggcctgcaggagatttgcccgggcgccctccttgagcagtggtcatgggtcactg
cctggaagcccctcgctgcccccagcgcaggatgaggtgtttgagttccctggagtcact
gctggacacagggatttagacagcagagccatcacactggttacaggctcttctcgcaag
atctctgtgaggctacagagggccaccaccagccaggccacccagactgaacctgtctgg
tcagaggctggctggggggactcggggtcccacaccttccctaaaatgaaatccaagttc
catgacaaagcagcaaaggacaaaggctttgccaaatgggaaaatgagaagcccagggtg
catgctggtgtggatgttgtagaccggggcacggagtttgaacttgaccaggatgaagga
gaagagaccagacaggatggtgaggatggctga

DBGET integrated database retrieval system