KEGG   Homo sapiens (human): 25792
Entry
25792             CDS       T01001                                 
Symbol
CIZ1, LSFR1, NP94, ZNF356
Name
(RefSeq) CDKN1A interacting zinc finger protein 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: zf-C2H2_jaz zf-C2H2_2 zf-C2H2_4
Other DBs
NCBI-GeneID: 25792
NCBI-ProteinID: NP_001124488
OMIM: 611420
HGNC: 16744
Ensembl: ENSG00000148337
Pharos: Q9ULV3(Tbio)
UniProt: Q9ULV3 A0A024R885
Position
9:complement(128166065..128204222)
AA seq 898 aa
MFSQQQQQQLQQQQQQLQQLQQQQLQQQQLQQQQLLQLQQLLQQSPPQAPLPMAVSRGLP
PQQPQQPLLNLQGTNSASLLNGSMLQRALLLQQLQGLDQFAMPPATYDTAGLTMPTATLG
NLRGYGMASPGLAAPSLTPPQLATPNLQQFFPQATRQSLLGPPPVGVPMNPSQFNLSGRN
PQKQARTSSSTTPNRKDSSSQTMPVEDKSDPPEGSEEAAEPRMDTPEDQDLPPCPEDIAK
EKRTPAPEPEPCEASELPAKRLRSSEEPTEKEPPGQLQVKAQPQARMTVPKQTQTPDLLP
EALEAQVLPRFQPRVLQVQAQVQSQTQPRIPSTDTQVQPKLQKQAQTQTSPEHLVLQQKQ
VQPQLQQEAEPQKQVQPQVQPQAHSQGPRQVQLQQEAEPLKQVQPQVQPQAHSQPPRQVQ
LQLQKQVQTQTYPQVHTQAQPSVQPQEHPPAQVSVQPPEQTHEQPHTQPQVSLLAPEQTP
VVVHVCGLEMPPDAVEAGGGMEKTLPEPVGTQVSMEEIQNESACGLDVGECENRAREMPG
VWGAGGSLKVTILQSSDSRAFSTVPLTPVPRPSDSVSSTPAATSTPSKQALQFFCYICKA
SCSSQQEFQDHMSEPQHQQRLGEIQHMSQACLLSLLPVPRDVLETEDEEPPPRRWCNTCQ
LYYMGDLIQHRRTQDHKIAKQSLRPFCTVCNRYFKTPRKFVEHVKSQGHKDKAKELKSLE
KEIAGQDEDHFITVDAVGCFEGDEEEEEDDEDEEEIEVEEELCKQVRSRDISREEWKGSE
TYSPNTAYGVDFLVPVMGYICRICHKFYHSNSGAQLSHCKSLGHFENLQKYKAAKNPSPT
TRPVSRRCAINARNALTALFTSSGRPPSQPNTQDKTPSKVTARPSQPPLPRRSTRLKT
NT seq 2697 nt   +upstreamnt  +downstreamnt
atgttcagccagcagcagcagcagcagctccagcaacagcagcagcagctccagcagtta
cagcagcagcagctccagcagcagcaattgcagcagcagcagttactgcagctccagcag
ctgctccagcagtccccaccacaggccccgttgcccatggctgtcagccgggggctcccc
ccgcagcagccacagcagccgcttctgaatctccagggcaccaactcagcctccctcctc
aacggctccatgctgcagagagctttgcttttacagcagttgcaaggactggaccagttt
gcaatgccaccagccacgtatgacactgccggtctcaccatgcccacagcaacactgggt
aacctccgaggctatggcatggcatccccaggcctcgcagcccccagcctcacaccccca
caactggccactccaaatttgcaacagttctttccccaggccactcgccagtccttgctg
ggacctcctcctgttggggtccccatgaacccttcccagttcaacctttcaggacggaac
ccccagaaacaggcccggacctcctcctctaccacccccaatcgaaaggattcttcttct
cagacaatgcctgtggaagacaagtcagaccccccagaggggtctgaggaagccgcagag
ccccggatggacacaccagaagaccaagatttaccgccctgcccagaggacatcgccaag
gaaaaacgcactccagcacctgagcctgagccttgtgaggcgtccgagctgccagcaaag
agattgaggagctcagaagagcccacagagaaggaacctccagggcagttacaggtgaag
gcccagccgcaggcccggatgacagtaccgaaacagacacagacaccagacctgctgcct
gaggccctggaagcccaagtgctgccacgattccagccacgggtcctgcaggtccaggcc
caggtgcagtcacagactcagccgcggataccatccacagacacccaggtgcagccaaag
ctgcagaagcaggcgcaaacacagacctctccagagcacttagtgctgcaacagaagcag
gtgcagccacagctgcagcaggaggcagagccacagaagcaggtgcagccacaggtacag
ccacaggcacattcacagggcccaaggcaggtgcagctgcagcaggaggcagagccgctg
aagcaggtgcagccacaggtgcagccccaggcacattcacagcccccaaggcaggtgcag
ctgcagctgcagaagcaggtccagacacagacatatccacaggtccacacacaggcacag
ccaagcgtccagccacaggagcatcctccagcgcaggtgtcagtacagccaccagagcag
acccatgagcagcctcacacccagccgcaggtgtcgttgctggctccagagcaaacacca
gttgtggttcatgtctgcgggctggagatgccacctgatgcagtagaagctggtggaggc
atggaaaagaccttgccagagcctgtgggcacccaagtcagcatggaagagattcagaat
gagtcggcctgtggcctagatgtgggagaatgtgaaaacagagcgagagagatgccaggg
gtatggggcgccgggggctccctgaaggtcaccattctgcagagcagtgacagccgggcc
tttagcactgtacccctgacacctgtcccccgccccagtgactccgtctcctccacccct
gcggctaccagcactccctctaagcaggccctccagttcttctgctacatctgcaaggcc
agctgctccagccagcaggagttccaggaccacatgtcggagcctcagcaccagcagcgg
ctaggggagatccagcacatgagccaagcctgcctcctgtccctgctgcccgtgccccgg
gacgtcctggagacagaggatgaggagcctccaccaaggcgctggtgcaacacctgccag
ctctactacatgggggacctgatccaacaccgcaggacacaggaccacaagattgccaaa
caatccttgcgacccttctgcaccgtttgcaaccgctacttcaaaacccctcgcaagttt
gtggagcacgtgaagtcccaggggcataaggacaaagccaaggagctgaagtcgcttgag
aaagaaattgctggccaagatgaggaccacttcattacagtggacgctgtgggttgcttc
gagggtgatgaagaagaggaagaggatgatgaggatgaagaagagatcgaggttgaggag
gaactctgcaagcaggtgaggtccagagatatatccagagaggagtggaagggctcggag
acctacagccccaatactgcatatggtgtggacttcctggtgcccgtgatgggctatatc
tgccgcatctgccacaagttctatcacagcaactcaggggcacagctctcccactgcaag
tccctgggccactttgagaacctgcagaaatacaaggcggccaagaaccccagccccacc
acccgacctgtgagccgccggtgcgcaatcaacgcccggaacgctttgacagccctgttc
acctccagcggccgcccaccctcccagcccaacacccaggacaaaacacccagcaaggtg
acggctcgaccctcccagcccccactacctcggcgctcaacccgcctcaaaacctga

DBGET integrated database retrieval system