KEGG   Homo sapiens (human): 25793
Entry
25793             CDS       T01001                                 

Gene name
FBXO7, FBX, FBX07, FBX7, PARK15, PKPS
Definition
(RefSeq) F-box protein 7
  KO
K10293  F-box protein 7
Organism
hsa  Homo sapiens (human)
Disease
H00057  Parkinson disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    25793 (FBXO7)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     25793 (FBXO7)
SSDB
Motif
Pfam: F-box-like PI31_Prot_N F-box
Other DBs
NCBI-GeneID: 25793
NCBI-ProteinID: NP_036311
OMIM: 605648
HGNC: 13586
Ensembl: ENSG00000100225
Vega: OTTHUMG00000030674
Pharos: Q9Y3I1(Tbio)
UniProt: Q9Y3I1
Structure
PDB: 
4L9H 4L9C

Position
22q12.3
AA seq 522 aa
MRLRVRLLKRTWPLEVPETEPTLGHLRSHLRQSLLCTWGYSSNTRFTITLNYKDPLTGDE
ETLASYGIVSGDLICLILQDDIPAPNIPSSTDSEHSSLQNNEQPSLATSSNQTSMQDEQP
SDSFQGQAAQSGVWNDDSMLGPSQNFEAESIQDNAHMAEGTGFYPSEPMLCSESVEGQVP
HSLETLYQSADCSDANDALIVLIHLLMLESGYIPQGTEAKALSMPEKWKLSGVYKLQYMH
PLCEGSSATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPESFICKEKLGENVANIYKD
LQKLSRLFKDQLVYPLLAFTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCR
DLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTH
TIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLPYVGDPISSLIPGPGETPSQFPPLRP
RFDPVGPLPGPNPILPGRGGPNDRFPFRPSRGRPTDGRLSFM
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgaggctgcgggtgcggcttctgaagcggacctggccgctggaggtgcccgagacggag
ccgacgctggggcatttgcgctcgcacctgaggcagtccctgctgtgcacctgggggtac
agttctaatacccgatttacaattacattgaactacaaggatcccctcactggagatgaa
gagaccttggcttcatatgggattgtttctggggacttgatatgtttgattcttcaagat
gacattccagcgcctaatataccttcatccacagattcagagcattcttcactccagaat
aatgagcaaccctctttggccaccagctccaatcagactagcatgcaggatgaacaacca
agtgattcattccaaggacaggcagcccagtctggtgtttggaatgacgacagtatgtta
gggcctagtcaaaattttgaagctgagtcaattcaagataatgcgcatatggcagagggc
acaggtttctatccctcagaacccatgctctgtagtgaatcggtggaagggcaagtgcca
cattcattagagaccttgtatcaatcagctgactgttctgatgccaatgatgccttgata
gtgttgatacatcttctcatgttggagtcaggttacatacctcagggcaccgaagccaaa
gcactgtccatgccggagaagtggaagttgagcggggtgtataagctgcagtacatgcat
cctctctgcgagggcagctccgctactctcacctgtgtgcctttgggaaacctgattgtt
gtaaatgctacactaaaaatcaacaatgagattagaagtgtgaaaagattgcagctgcta
ccagaatcttttatttgcaaagagaaactaggggaaaatgtagccaacatatacaaagat
cttcagaaactctctcgcctctttaaagaccagctggtgtatcctcttctggcttttacc
cgacaagcactgaacctaccagatgtatttgggttggtcgtcctcccattggaactgaaa
ctacggatcttccgacttctggatgttcgttccgtcttgtctttgtctgcggtttgtcgt
gacctctttactgcttcaaatgacccactcctgtggaggtttttatatctgcgtgatttt
cgagacaatactgtcagagttcaagacacagattggaaagaactgtacaggaagaggcac
atacaaagaaaagaatccccgaaagggcggtttgtgatgctcctgccatcgtcaactcac
accattccattctatcccaaccccttgcaccctaggccatttcctagctcccgccttcct
ccaggaattatcgggggtgaatatgaccaaagaccaacacttccctatgttggagaccca
atcagttcactcattcctggtcctggggagacgcccagccagtttcctccactgagacca
cgctttgatccagttggcccacttccaggacctaaccccatcttgccagggcgaggcggc
cccaatgacagatttccctttagacccagcaggggtcggccaactgatggccggctgtca
ttcatgtga

DBGET integrated database retrieval system