KEGG   Homo sapiens (human): 25794Help
Entry
25794             CDS       T01001                                 

Gene name
FSCN2, RFSN, RP30
Definition
(RefSeq) fascin actin-bundling protein 2, retinal
  KO
K17455  fascin2
Organism
hsa  Homo sapiens (human)
Disease
H00527  Retinitis pigmentosa
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    25794 (FSCN2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     25794 (FSCN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fascin FRG1 FGF DUF569
Motif
Other DBs
NCBI-GeneID: 25794
NCBI-ProteinID: NP_036550
OMIM: 607643
HGNC: 3960
Ensembl: ENSG00000186765
Vega: OTTHUMG00000167477
Pharos: O14926(Tbio)
UniProt: O14926
Position
17q25.3
AA seq 492 aa AA seqDB search
MPTNGLHQVLKIQFGLVNDTDRYLTAESFGFKVNASAPSLKRKQTWVLEPDPGQGTAVLL
RSSHLGRYLSAEEDGRVACEAEQPGRDCRFLVLPQPDGRWVLRSEPHGRFFGGTEDQLSC
FATAVSPAELWTVHLAIHPQAHLLSVSRRRYVHLCPREDEMAADGDKPWGVDALLTLIFR
SRRYCLKSCDSRYLRSDGRLVWEPEPRACYTLEFKAGKLAFKDCDGHYLAPVGPAGTLKA
GRNTRPGKDELFDLEESHPQVVLVAANHRYVSVRQGVNVSANQDDELDHETFLMQIDQET
KKCTFYSSTGGYWTLVTHGGIHATATQVSANTMFEMEWRGRRVALKASNGRYVCMKKNGQ
LAAISDFVGKDEEFTLKLINRPILVLRGLDGFVCHHRGSNQLDTNRSVYDVFHLSFSDGA
YRIRGRDGGFWYTGSHGSVCSDGERAEDFVFEFRERGRLAIRARSGKYLRGGASGLLRAD
ADAPAGTALWEY
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgccgacgaacggcctgcaccaggtgctgaagatccagtttggcctcgtcaacgacact
gaccgctacctgacagctgagagcttcggcttcaaggtcaatgcctcggcacccagcctc
aagaggaagcagacctgggtgctggaacccgacccaggacaaggcacggctgtgctgctc
cgcagcagccacctgggccgctacctgtcggcagaagaggacgggcgcgtggcctgtgag
gcagagcagccgggccgtgactgccgcttcctggtcctgccgcagccagatgggcgctgg
gtgctgcggtccgagccgcacggccgcttcttcggaggcaccgaggaccagctgtcctgc
ttcgccacagccgtttccccggccgagctgtggaccgtgcacctggccatccacccgcag
gcccacctgctgagcgtgagccggcggcgctacgtgcacctgtgcccgcgggaggacgag
atggccgcagacggagacaagccctggggcgtggacgccctcctcaccctcatcttccgg
agccgacggtactgcctcaagtcctgtgacagccgctacctgcgcagcgacggccgtctg
gtctgggagcctgagccccgtgcctgctacacgctggagttcaaggcgggcaagctggcc
ttcaaggactgcgacggccactacctggcacccgtggggcccgcaggcaccctcaaggcc
ggccgaaacacgcgacctggcaaggatgagctctttgatctggaggagagtcacccacag
gtggtgctggtggctgccaaccaccgctacgtctctgtgcggcaaggggtcaacgtctca
gccaatcaggatgatgaactagaccacgagaccttcctgatgcaaattgaccaggagaca
aagaagtgcaccttctattccagcactgggggctactggaccctggtcacccatgggggc
attcacgccacagccacacaagtttctgccaacaccatgtttgagatggagtggcgtggc
cggcgggtagcactcaaagccagcaacgggcgctacgtgtgcatgaagaagaatgggcag
ctggcggctatcagcgattttgtcggcaaggacgaagagttcaccctcaagctcatcaac
cggcccatcctggtgctgcgcggcctggacggcttcgtctgccaccaccgcggctccaac
cagctggacaccaaccgctccgtctacgacgtcttccacctgagcttcagcgacggcgcc
taccggatccgaggccgcgacggagggttctggtacacgggcagccacggcagcgtgtgc
agcgacggcgaacgcgccgaggacttcgtcttcgagttccgtgagcgcggccgcctggcc
atccgcgcccggagcggcaagtacctgcgcggcggcgcctcgggcctgctgcgggccgat
gccgacgccccggccgggaccgcgctttgggagtactga

DBGET integrated database retrieval system