KEGG   Homo sapiens (human): 25796
Entry
25796             CDS       T01001                                 

Gene name
PGLS, 6PGL, HEL-S-304
Definition
(RefSeq) 6-phosphogluconolactonase
  KO
K01057  6-phosphogluconolactonase [EC:3.1.1.31]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00030  Pentose phosphate pathway
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
Module
hsa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
hsa_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    25796 (PGLS)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     25796 (PGLS)
SSDB
Motif
Pfam: Glucosamine_iso Ntox10
Other DBs
NCBI-GeneID: 25796
NCBI-ProteinID: NP_036220
OMIM: 604951
HGNC: 8903
Ensembl: ENSG00000130313
Vega: OTTHUMG00000182879
Pharos: O95336(Tbio)
UniProt: O95336 A0A0K0K1K7
Position
19p13.11
AA seq 258 aa
MAAPAPGLISVFSSSQELGAALAQLVAQRAACCLAGARARFALGLSGGSLVSMLARELPA
AVAPAGPASLARWTLGFCDERLVPFDHAESTYGLYRTHLLSRLPIPESQVITINPELPVE
EAAEDYAKKLRQAFQGDSIPVFDLLILGVGPDGHTCSLFPDHPLLQEREKIVAPISDSPK
PPPQRVTLTLPVLNAARTVIFVATGEGKAAVLKRILEDQEENPLPAALVQPHTGKLCWFL
DEAAARLLTVPFEKHSTL
NT seq 777 nt   +upstreamnt  +downstreamnt
atggccgcgccggccccgggcctcatctcggtgttctcgagttcccaggagctgggtgcg
gcgctagcgcagctggtggcccagcgcgcagcatgctgcctggcaggggcccgcgcccgt
ttcgcgctcggcctgtcgggcgggagcctcgtctcgatgctagcccgcgagctacccgcc
gccgtcgcccctgccgggccagctagcttagcgcgctggacgctgggcttctgcgacgag
cgcctcgtgcccttcgatcacgccgagagcacgtacggcctctaccggacgcatcttctc
tccagactgccgatcccagaaagccaggtgatcaccattaaccccgagctgcctgtggag
gaggcggctgaggactacgccaagaagctgagacaggcattccaaggggactccatcccg
gttttcgacctgctgatcctgggggtgggccccgatggtcacacctgctcactcttccca
gaccaccccctcctacaggagcgggagaagattgtggctcccatcagtgactccccgaag
ccaccgccacagcgtgtgaccctcacactacctgtcctgaatgcagcacgaactgtcatc
tttgtggcaactggagaaggcaaggcagctgttctgaagcgcattttggaggaccaggag
gaaaacccgctgcccgccgccctggtccagccccacaccgggaaactgtgctggttcttg
gacgaggcggccgcccgcctcctgaccgtgcccttcgagaagcattccactttgtag

DBGET integrated database retrieval system