KEGG   Homo sapiens (human): 25797Help
Entry
25797             CDS       T01001                                 

Gene name
QPCT, GCT, QC, sQC
Definition
(RefSeq) glutaminyl-peptide cyclotransferase
  KO
K00683  glutaminyl-peptide cyclotransferase [EC:2.3.2.5]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    25797 (QPCT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.5  glutaminyl-peptide cyclotransferase
     25797 (QPCT)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   25797 (QPCT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M28 Exog_C
Motif
Other DBs
NCBI-GeneID: 25797
NCBI-ProteinID: NP_036545
OMIM: 607065
HGNC: 9753
Ensembl: ENSG00000115828
Vega: OTTHUMG00000100963
Pharos: Q16769(Tchem)
UniProt: Q16769
Structure
PDB: 

Position
2p22.2
AA seq 361 aa AA seqDB search
MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGT
SISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSF
SNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLS
LKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHG
MDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYG
GVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLH
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcggaagacaccggcgcgtcgtgggcaccctccacctgctgctgctggtggcc
gccctgccctgggcatccaggggggtcagtccgagtgcctcagcctggccagaggagaag
aattaccaccagccagccattttgaattcatcggctcttcggcaaattgcagaaggcacc
agtatctctgaaatgtggcaaaatgacttacagccattgctgatagagcgatacccggga
tcccctggaagctatgctgctcgtcagcacatcatgcagcgaattcagaggcttcaggct
gactgggtcttggaaatagacaccttcttgagtcagacaccctatgggtaccggtctttc
tcaaatatcatcagcaccctcaatcccactgctaaacgacatttggtcctcgcctgccac
tatgactccaagtatttttcccactggaacaacagagtgtttgtaggagccactgattca
gccgtgccatgtgcaatgatgttggaacttgctcgtgccttagacaagaaactcctttcc
ttaaagactgtttcagactccaagccagatttgtcactccagctgatcttctttgatggt
gaagaggcttttcttcactggtctcctcaagattctctctatgggtctcgacacttagct
gcaaagatggcatcgaccccgcacccacctggagcgagaggcaccagccaactgcatggc
atggatttattggtcttattggatttgattggagctccaaacccaacgtttcccaatttt
tttccaaactcagccaggtggttcgaaagacttcaagcaattgaacatgaacttcatgaa
ttgggtttgctcaaggatcactctttggaggggcggtatttccagaattacagttatgga
ggtgtgattcaggatgaccatattccatttttaagaagaggtgttccagttctgcatctg
ataccgtctcctttccctgaagtctggcacaccatggatgacaatgaagaaaatttggat
gaatcaaccattgacaatctaaacaaaatcctacaagtctttgtgttggaatatcttcat
ttgtaa

DBGET integrated database retrieval system