KEGG   Homo sapiens (human): 25798
Entry
25798             CDS       T01001                                 

Gene name
BRI3, I3
Definition
(RefSeq) brain protein I3
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF2367
Other DBs
NCBI-GeneID: 25798
NCBI-ProteinID: NP_056194
OMIM: 615628
HGNC: 1109
Ensembl: ENSG00000164713
Vega: OTTHUMG00000154275
Pharos: O95415(Tbio)
UniProt: O95415
Position
7q21.3
AA seq 125 aa
MDHKPLLQERPPAYNLEAGQGDYACGPHGYGAIPAAPPPPPYPYLVTGIPTHHPRVYNIH
SRTVTRYPANSIVVVGGCPVCRVGVLEDCFTFLGIFLAIILFPFGFICCFALRKRRCPNC
GATFA
NT seq 378 nt   +upstreamnt  +downstreamnt
atggaccacaagccgctgctgcaggagcggccgcccgcctacaacctggaggccggccag
ggcgactacgcgtgcggcccgcacggctacggcgccatccccgccgcgcccccgccgccg
ccctacccctacctcgtcacagggatacccacccaccatcccagggtctacaacatccac
agccggaccgtcacccgctatcctgccaactctatcgtggtcgtaggaggctgtcctgtc
tgcagggttggggtgctggaggactgcttcaccttcctgggcatcttcctggccatcatc
ctcttcccctttgggttcatttgctgttttgccttgaggaagcgacgatgccccaactgt
ggagccaccttcgcttaa

DBGET integrated database retrieval system