KEGG   Homo sapiens (human): 25800Help
Entry
25800             CDS       T01001                                 

Gene name
SLC39A6, LIV-1, ZIP6
Definition
(RefSeq) solute carrier family 39 member 6
  KO
K14712  solute carrier family 39 (zinc transporter), member 6
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    25800 (SLC39A6)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC39: Metal ion transporter
   25800 (SLC39A6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Zip DUF2313
Motif
Other DBs
NCBI-GeneID: 25800
NCBI-ProteinID: NP_036451
OMIM: 608731
HGNC: 18607
Ensembl: ENSG00000141424
Vega: OTTHUMG00000178965
Pharos: Q13433(Tbio)
UniProt: Q13433
Position
18q12.2
AA seq 755 aa AA seqDB search
MARKLSVILILTFALSVTNPLHELKAAAFPQTTEKISPNWESGINVDLAISTRQYHLQQL
FYRYGENNSLSVEGFRKLLQNIGIDKIKRIHIHHDHDHHSDHEHHSDHERHSDHEHHSEH
EHHSDHDHHSHHNHAASGKNKRKALCPDHDSDSSGKDPRNSQGKGAHRPEHASGRRNVKD
SVSASEVTSTVYNTVSEGTHFLETIETPRPGKLFPKDVSSSTPPSVTSKSRVSRLAGRKT
NESVSEPRKGFMYSRNTNENPQECFNASKLLTSHGMGIQVPLNATEFNYLCPAIINQIDA
RSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMNRVFFKFLLSF
LVALAVGTLSGDAFLHLLPHSHASHHHSHSHEEPAMEMKRGPLFSHLSSQNIEESAYFDS
TWKGLTALGGLYFMFLVEHVLTLIKQFKDKKKKNQKKPENDDDVEIKKQLSKYESQLSTN
EEKVDTDDRTEGYLRADSQEPSHFDSQQPAVLEEEEVMIAHAHPQEVYNEYVPRGCKNKC
HSHFHDTLGQSDDLIHHHHDYHHILHHHHHQNHHPHSHSQRYSREELKDAGVATLAWMVI
MGDGLHNFSDGLAIGAAFTEGLSSGLSTSVAVFCHELPHELGDFAVLLKAGMTVKQAVLY
NALSAMLAYLGMATGIFIGHYAENVSMWIFALTAGLFMYVALVDMVPEMLHNDASDHGCS
RWGYFFLQNAGMLLGFGIMLLISIFEHKIVFRINF
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggaagttatctgtaatcttgatcctgacctttgccctctctgtcacaaatccc
cttcatgaactaaaagcagctgctttcccccagaccactgagaaaattagtccgaattgg
gaatctggcattaatgttgacttggcaatttccacacggcaatatcatctacaacagctt
ttctaccgctatggagaaaataattctttgtcagttgaagggttcagaaaattacttcaa
aatataggcatagataagattaaaagaatccatatacaccatgaccacgaccatcactca
gaccacgagcatcactcagaccatgagcgtcactcagaccatgagcatcactcagagcac
gagcatcactctgaccatgatcatcactctcaccataatcatgctgcttctggtaaaaat
aagcgaaaagctctttgcccagaccatgactcagatagttcaggtaaagatcctagaaac
agccaggggaaaggagctcaccgaccagaacatgccagtggtagaaggaatgtcaaggac
agtgttagtgctagtgaagtgacctcaactgtgtacaacactgtctctgaaggaactcac
tttctagagacaatagagactccaagacctggaaaactcttccccaaagatgtaagcagc
tccactccacccagtgtcacatcaaagagccgggtgagccggctggctggtaggaaaaca
aatgaatctgtgagtgagccccgaaaaggctttatgtattccagaaacacaaatgaaaat
cctcaggagtgtttcaatgcatcaaagctactgacatctcatggcatgggcatccaggtt
ccgctgaatgcaacagagttcaactatctctgtccagccatcatcaaccaaattgatgct
agatcttgtctgattcatacaagtgaaaagaaggctgaaatccctccaaagacctattca
ttacaaatagcctgggttggtggttttatagccatttccatcatcagtttcctgtctctg
ctgggggttatcttagtgcctctcatgaatcgggtgtttttcaaatttctcctgagtttc
cttgtggcactggccgttgggactttgagtggtgatgcttttttacaccttcttccacat
tctcatgcaagtcaccaccatagtcatagccatgaagaaccagcaatggaaatgaaaaga
ggaccacttttcagtcatctgtcttctcaaaacatagaagaaagtgcctattttgattcc
acgtggaagggtctaacagctctaggaggcctgtatttcatgtttcttgttgaacatgtc
ctcacattgatcaaacaatttaaagataagaagaaaaagaatcagaagaaacctgaaaat
gatgatgatgtggagattaagaagcagttgtccaagtatgaatctcaactttcaacaaat
gaggagaaagtagatacagatgatcgaactgaaggctatttacgagcagactcacaagag
ccctcccactttgattctcagcagcctgcagtcttggaagaagaagaggtcatgatagct
catgctcatccacaggaagtctacaatgaatatgtacccagagggtgcaagaataaatgc
cattcacatttccacgatacactcggccagtcagacgatctcattcaccaccatcatgac
taccatcatattctccatcatcaccaccaccaaaaccaccatcctcacagtcacagccag
cgctactctcgggaggagctgaaagatgccggcgtcgccactctggcctggatggtgata
atgggtgatggcctgcacaatttcagcgatggcctagcaattggtgctgcttttactgaa
ggcttatcaagtggtttaagtacttctgttgctgtgttctgtcatgagttgcctcatgaa
ttaggtgactttgctgttctactaaaggctggcatgaccgttaagcaggctgtcctttat
aatgcattgtcagccatgctggcgtatcttggaatggcaacaggaattttcattggtcat
tatgctgaaaatgtttctatgtggatatttgcacttactgctggcttattcatgtatgtt
gctctggttgatatggtacctgaaatgctgcacaatgatgctagtgaccatggatgtagc
cgctgggggtatttctttttacagaatgctgggatgcttttgggttttggaattatgtta
cttatttccatatttgaacataaaatcgtgtttcgtataaatttctag

DBGET integrated database retrieval system