KEGG   Homo sapiens (human): 25807
Entry
25807             CDS       T01001                                 
Symbol
RHBDD3, C22orf3, HS984G1A, PTAG
Name
(RefSeq) rhomboid domain containing 3
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Rhomboid UBA DctA-YdbH
Other DBs
NCBI-GeneID: 25807
NCBI-ProteinID: NP_001316465
HGNC: 1308
Ensembl: ENSG00000100263
Pharos: Q9Y3P4(Tbio)
UniProt: Q9Y3P4 A0A024R1J2
Position
22:complement(29259852..29268163)
AA seq 386 aa
MHARGPHGQLSPALPLASSVLMLLMSTLWLVGAGPGLVLAPELLLDPWQVHRLLTHALGH
TALPGLLLSLLLLPTVGWQQECHLGTLRFLHASALLALASGLLAVLLAGLGLSSAAGSCG
YMPVHLAMLAGEGHRPRRPRGALPPWLSPWLLLALTPLLSSEPPFLQLLCGLLAGLAYAA
GAFRWLEPSERRLQVLQEGVLCRTLAGCWPLRLLATPGSLAELPVTHPAGVRPPIPGPPY
VASPDLWSHWEDSALPPPSLRPVQPTWEGSSEAGLDWAGASFSPGTPMWAALDEQMLQEG
IQASLLDGPAQEPQSAPWLSKSSVSSLRLQQLERMGFPTEQAVVALAATGRVEGAVSLLV
GGQVGTETLVTHGKGGPAHSEGPGPP
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgcatgccaggggcccccatggccaactgtccccagcactgcctctggcctcctcagtc
ctgatgctgctgatgagcaccctgtggctggtgggggccggccccggcctggtcctggcc
ccggagctgttgctggacccctggcaggtgcaccggctgctgacccatgccctgggccac
acggccctgccaggcctgctcctgagcctgctgctcctgcccactgtgggctggcagcag
gagtgccacctgggcacgctgagattcctgcatgcctcagccctgctcgccctggcttct
gggctgctggcagtgctgctggcaggccttgggctgtccagtgcagccggcagctgtgga
tacatgcctgtccacctggccatgctggctggggagggacaccgccctagacggccccgt
ggggcactgccaccgtggctgtcgccgtggctgctgcttgccctgaccccactgctcagc
tctgagccacccttcctgcagctcctttgcggcctccttgccggcctggcctatgcagct
ggggccttccggtggctggaaccctcagagcgacggctgcaggtgctgcaggagggcgtc
ttgtgcaggaccttggcggggtgctggcccctgaggctccttgccaccccgggtagcctg
gcggagctgcctgtcacccatcctgccggagtgaggcctcccatccctggaccgccttat
gtggcctcccctgacctctggtcccactgggaagactcagccctgcccccaccaagcctg
aggcctgtgcagcccacctgggagggctcctcagaggcaggcctggactgggctggggcc
agcttctccccagggactccgatgtgggcggccttggatgagcagatgctgcaggagggc
atccaggcctcgcttcttgacgggccagcccaggaaccccagagcgcaccatggctgtcc
aagtcctctgtctcctctctgcggctgcagcagctggagcgcatgggcttccctacggag
caggcggtggtggcactggcagccacaggccgtgtggagggtgccgtgtcactgttggtt
ggaggacaagtgggcactgagaccctggtgacccatggaaagggtgggcctgcccactcc
gagggtcctgggcctccctag

DBGET integrated database retrieval system