KEGG   Homo sapiens (human): 25816Help
Entry
25816             CDS       T01001                                 

Gene name
TNFAIP8, GG2-1, MDC-3.13, NDED, SCC-S2, SCCS2
Definition
(RefSeq) TNF alpha induced protein 8
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF758 DUF2857 Pico_P2B DUF459 ArAE_1_C EMC3_TMCO1 MRC1
Motif
Other DBs
NCBI-GeneID: 25816
NCBI-ProteinID: NP_001273742
OMIM: 612111
HGNC: 17260
Ensembl: ENSG00000145779
Vega: OTTHUMG00000162949
Pharos: O95379(Tbio)
UniProt: O95379 B3KUI2
Position
5q23.1
AA seq 198 aa AA seqDB search
MHSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTRE
YTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVD
YTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKP
HLQKLCDGINKMLDEENI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcactccgaagcagaagaatccaaggaagtggccacagatgtctttaattccaaaaac
ctggccgttcaggcacaaaagaagatcttgggtaaaatggtgtccaaatccatcgccacc
accttaatagacgacacaagtagtgaggtgctggatgagctctacagagtgaccagggag
tacacccaaaacaagaaggaggcagagaagatcatcaagaacctcatcaagacagtcatc
aagctggccattctttataggaataatcagtttaatcaagatgagctagcattgatggag
aaatttaagaagaaagttcatcagcttgctatgaccgtggtcagtttccatcaggtggat
tatacctttgaccggaatgtgttatccaggctgttaaatgaatgcagagagatgctgcac
caaatcattcagcgccacctcactgccaagtcacatggacgggttaataatgtgtttgat
catttttcagattgtgaatttttggctgccttgtataatccttttgggaattttaaaccc
cacttacaaaaactatgtgatggtatcaacaaaatgttggatgaagagaacatatga

DBGET integrated database retrieval system