KEGG   Homo sapiens (human): 25818Help
Entry
25818             CDS       T01001                                 

Gene name
KLK5, KLK-L2, KLKL2, SCTE
Definition
(RefSeq) kallikrein related peptidase 5
  KO
K09617  kallikrein 5 [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     25818 (KLK5)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   25818 (KLK5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 25818
NCBI-ProteinID: NP_001070959
OMIM: 605643
HGNC: 6366
Ensembl: ENSG00000167754
Vega: OTTHUMG00000183097
Pharos: Q9Y337(Tchem)
UniProt: Q9Y337
Structure
PDB: 

Position
19q13.41
AA seq 293 aa AA seqDB search
MATARPPWMWVLCALITALLLGVTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARS
DDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGH
YSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPS
AGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDS
CQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggctacagcaagacccccctggatgtgggtgctctgtgctctgatcacagccttgctt
ctgggggtcacagagcatgttctcgccaacaatgatgtttcctgtgaccacccctctaac
accgtgccctctgggagcaaccaggacctgggagctggggccggggaagacgcccggtcg
gatgacagcagcagccgcatcatcaatggatccgactgcgatatgcacacccagccgtgg
caggccgcgctgttgctaaggcccaaccagctctactgcggggcggtgttggtgcatcca
cagtggctgctcacggccgcccactgcaggaagaaagttttcagagtccgtctcggccac
tactccctgtcaccagtttatgaatctgggcagcagatgttccagggggtcaaatccatc
ccccaccctggctactcccaccctggccactctaacgacctcatgctcatcaaactgaac
agaagaattcgtcccactaaagatgtcagacccatcaacgtctcctctcattgtccctct
gctgggacaaagtgcttggtgtctggctgggggacaaccaagagcccccaagtgcacttc
cctaaggtcctccagtgcttgaatatcagcgtgctaagtcagaaaaggtgcgaggatgct
tacccgagacagatagatgacaccatgttctgcgccggtgacaaagcaggtagagactcc
tgccagggtgattctggggggcctgtggtctgcaatggctccctgcagggactcgtgtcc
tggggagattacccttgtgcccggcccaacagaccgggtgtctacacgaacctctgcaag
ttcaccaagtggatccaggaaaccatccaggccaactcctga

DBGET integrated database retrieval system