KEGG   Homo sapiens (human): 25822Help
Entry
25822             CDS       T01001                                 

Gene name
DNAJB5, Hsc40
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member B5
  KO
K09511  DnaJ homolog subfamily B member 5
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    25822 (DNAJB5)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP40 / DNAJ
   25822 (DNAJB5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DnaJ_C DnaJ
Motif
Other DBs
NCBI-GeneID: 25822
NCBI-ProteinID: NP_036398
OMIM: 611328
HGNC: 14887
Ensembl: ENSG00000137094
Vega: OTTHUMG00000019840
Pharos: O75953(Tbio)
UniProt: O75953
Position
9p13.3
AA seq 348 aa AA seqDB search
MGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEIAEAYDVLSDPKK
RGLYDQYGEEGLKTGGGTSGGSSGSFHYTFHGDPHATFASFFGGSNPFDIFFASSRSTRP
FSGFDPDDMDVDEDEDPFGAFGRFGFNGLSRGPRRAPEPLYPRRKVQDPPVVHELRVSLE
EIYHGSTKRMKITRRRLNPDGRTVRTEDKILHIVIKRGWKEGTKITFPKEGDATPDNIPA
DIVFVLKDKPHAHFRRDGTNVLYSALISLKEALCGCTVNIPTIDGRVIPLPCNDVIKPGT
VKRLRGEGLPFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQHLPCS
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagattattacaagattcttgggatcccatcgggggccaacgaggatgagatc
aagaaagcctaccggaagatggccttgaagtaccacccagacaagaataaagaacccaac
gctgaggagaagtttaaggagattgcagaggcctatgatgtgctaagtgaccccaagaaa
cggggcctgtatgaccagtatggggaggaaggcctgaagaccggcggtggcacatcaggt
ggctccagtggctcctttcactacacctttcatggggacccccatgccacctttgcctcc
ttctttggtggctccaaccccttcgatatcttctttgccagcagccgctccactcggccc
ttcagtggctttgacccagatgacatggatgtggatgaagatgaggacccatttggcgct
ttcggccgttttggcttcaatgggctgagtaggggtccaaggcgagccccagaaccactg
taccctcggcgcaaggtgcaggaccccccagtggtgcacgagctgcgggtgtccctggag
gagatctaccatggctccaccaagcgcatgaagatcacaaggcgtcgcctcaaccctgat
gggcgaactgtgcgcaccgaggacaagatcctgcacatagtcatcaagcgtggctggaag
gaaggcaccaagatcaccttccccaaagaaggcgacgccacacctgacaacatccctgct
gacatcgtctttgtgctcaaagacaagccccatgcacacttccgccgagatggcaccaac
gtgctctacagtgccctgatcagcctcaaggaggcgctgtgtggctgcactgtgaacatt
cccactatcgacggccgagtgatccctttgccctgcaatgatgtcatcaagccaggcacc
gtgaagagactccgtggggagggccttcccttccccaaagtgccaactcagcgaggagac
ctcattgttgagttcaaagttcgcttcccagacagattaacaccacagacaagacagatc
cttaagcagcacctaccctgttcctag

DBGET integrated database retrieval system