KEGG   Homo sapiens (human): 25825Help
Entry
25825             CDS       T01001                                 

Gene name
BACE2, AEPLC, ALP56, ASP1, ASP21, BAE2, CDA13, CEAP1, DRAP
Definition
(RefSeq) beta-secretase 2
  KO
K07747  beta-site APP-cleaving enzyme 2 (memapsin 1) [EC:3.4.23.45]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05010  Alzheimer disease
Drug target
Verubecestat: D10739
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    25825 (BACE2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    25825 (BACE2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.45  memapsin 1
     25825 (BACE2)
Peptidases [BR:hsa01002]
 Aspartic Peptidases
  Family A1: pepsin family
   25825 (BACE2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asp TAXi_C TAXi_N
Motif
Other DBs
NCBI-GeneID: 25825
NCBI-ProteinID: NP_036237
OMIM: 605668
HGNC: 934
Ensembl: ENSG00000182240
Vega: OTTHUMG00000086742
Pharos: Q9Y5Z0(Tchem)
UniProt: Q9Y5Z0
Structure
PDB: 

Position
21q22.2-q22.3
AA seq 518 aa AA seqDB search
MGALARALLLPLLAQWLLRAAPELAPAPFTLPLRVAAATNRVVAPTPGPGTPAERHADGL
ALALEPALASPAGAANFLAMVDNLQGDSGRGYYLEMLIGTPPQKLQILVDTGSSNFAVAG
TPHSYIDTYFDTERSSTYRSKGFDVTVKYTQGSWTGFVGEDLVTIPKGFNTSFLVNIATI
FESENFFLPGIKWNGILGLAYATLAKPSSSLETFFDSLVTQANIPNVFSMQMCGAGLPVA
GSGTNGGSLVLGGIEPSLYKGDIWYTPIKEEWYYQIEILKLEIGGQSLNLDCREYNADKA
IVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGFWTGSQLACWTNSETPWSYFPKISI
YLRDENSSRSFRITILPQLYIQPMMGAGLNYECYRFGISPSTNALVIGATVMEGFYVIFD
RAQKRVGFAASPCAEIAGAAVSEISGPFSTEDVASNCVPAQSLSEPILWIVSYALMSVCG
AILLVLIVLLLLPFRCQRRPRDPEVVNDESSLVRHRWK
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcactggcccgggcgctgctgctgcctctgctggcccagtggctcctgcgcgcc
gccccggagctggcccccgcgcccttcacgctgcccctccgggtggccgcggccacgaac
cgcgtagttgcgcccaccccgggacccgggacccctgccgagcgccacgccgacggcttg
gcgctcgccctggagcctgccctggcgtcccccgcgggcgccgccaacttcttggccatg
gtagacaacctgcagggggactctggccgcggctactacctggagatgctgatcgggacc
cccccgcagaagctacagattctcgttgacactggaagcagtaactttgccgtggcagga
accccgcactcctacatagacacgtactttgacacagagaggtctagcacataccgctcc
aagggctttgacgtcacagtgaagtacacacaaggaagctggacgggcttcgttggggaa
gacctcgtcaccatccccaaaggcttcaatacttcttttcttgtcaacattgccactatt
tttgaatcagagaatttctttttgcctgggattaaatggaatggaatacttggcctagct
tatgccacacttgccaagccatcaagttctctggagaccttcttcgactccctggtgaca
caagcaaacatccccaacgttttctccatgcagatgtgtggagccggcttgcccgttgct
ggatctgggaccaacggaggtagtcttgtcttgggtggaattgaaccaagtttgtataaa
ggagacatctggtatacccctattaaggaagagtggtactaccagatagaaattctgaaa
ttggaaattggaggccaaagccttaatctggactgcagagagtataacgcagacaaggcc
atcgtggacagtggcaccacgctgctgcgcctgccccagaaggtgtttgatgcggtggtg
gaagctgtggcccgcgcatctctgattccagaattctctgatggtttctggactgggtcc
cagctggcgtgctggacgaattcggaaacaccttggtcttacttccctaaaatctccatc
tacctgagagacgagaactccagcaggtcattccgtatcacaatcctgcctcagctttac
attcagcccatgatgggggccggcctgaattatgaatgttaccgattcggcatttcccca
tccacaaatgcgctggtgatcggtgccacggtgatggagggcttctacgtcatcttcgac
agagcccagaagagggtgggcttcgcagcgagcccctgtgcagaaattgcaggtgctgca
gtgtctgaaatttccgggcctttctcaacagaggatgtagccagcaactgtgtccccgct
cagtctttgagcgagcccattttgtggattgtgtcctatgcgctcatgagcgtctgtgga
gccatcctccttgtcttaatcgtcctgctgctgctgccgttccggtgtcagcgtcgcccc
cgtgaccctgaggtcgtcaatgatgagtcctctctggtcagacatcgctggaaatga

DBGET integrated database retrieval system