KEGG   Homo sapiens (human): 25828Help
Entry
25828             CDS       T01001                                 

Gene name
TXN2, COXPD29, MT-TRX, MTRX, TRX2, TXN
Definition
(RefSeq) thioredoxin 2
  KO
K03671  thioredoxin 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
hsa05418  Fluid shear stress and atherosclerosis
Disease
H00891  Combined oxidative phosphorylation deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    25828 (TXN2)
 09160 Human Diseases
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    25828 (TXN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    25828 (TXN2)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Protein disulfide isomerase
   25828 (TXN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_2 Thioredoxin_7 Thioredoxin_3 Thioredoxin_8 DSBA Thioredoxin_9 AhpC-TSA DUF836
Motif
Other DBs
NCBI-GeneID: 25828
NCBI-ProteinID: NP_036605
OMIM: 609063
HGNC: 17772
Ensembl: ENSG00000100348
Vega: OTTHUMG00000150596
Pharos: Q99757(Tbio)
UniProt: Q99757
Structure
PDB: 

Position
22q12.3
AA seq 166 aa AA seqDB search
MAQRLLLRRFLASVISRKPSQGQWPPLTSRALQTPQCSPGGLTVTPNPARTIYTTRISLT
TFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDD
HTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggctcagcgacttcttctgaggaggttcctggcctctgtcatctccaggaagccctct
cagggtcagtggccacccctcacttccagagccctgcagaccccacaatgcagtcctggt
ggcctgactgtaacacccaacccagcccggacaatatacaccacgaggatctccttgaca
acctttaatatccaggatggacctgactttcaagaccgagtggtcaacagtgagacacca
gtggttgtggatttccacgcacagtggtgtggaccctgcaagatcctggggccgaggtta
gagaagatggtggccaagcagcacgggaaggtggtgatggccaaggtggatattgatgac
cacacagacctcgccattgagtatgaggtgtcagcggtgcccactgtgctggccatgaag
aatggggacgtggtggacaagtttgtgggcatcaaggatgaggatcagttggaggccttc
ctgaagaagctgattggctga

DBGET integrated database retrieval system