KEGG   Homo sapiens (human): 25830
Entry
25830             CDS       T01001                                 

Gene name
SULT4A1, BR-STL-1, BRSTL1, DJ388M5.3, NST, SULTX3, hBR-STL-1
Definition
(RefSeq) sulfotransferase family 4A member 1
  KO
K11823  sulfotransferase 4A1 [EC:2.8.2.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    25830 (SULT4A1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.-  
     25830 (SULT4A1)
SSDB
Motif
Pfam: Sulfotransfer_1 Sulfotransfer_3 FdsD
Other DBs
NCBI-GeneID: 25830
NCBI-ProteinID: NP_055166
OMIM: 608359
HGNC: 14903
Ensembl: ENSG00000130540
Vega: OTTHUMG00000141314
Pharos: Q9BR01(Tbio)
UniProt: Q9BR01
Structure
PDB: 
1ZD1

Position
22q13.31
AA seq 284 aa
MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSL
LQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSD
LHNGDSKVIYMARNPKDLVVSYYQFHRSLRTMSYRGTFQEFCRRFMNDKLGYGSWFEHVQ
EFWEHRMDSNVLFLKYEDMHRDLVTMVEQLARFLGVSCDKAQLEALTEHCHQLVDQCCNA
EALPVGRGRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYL
NT seq 855 nt   +upstreamnt  +downstreamnt
atggcggagagcgaggccgagacccccagcaccccgggggagttcgagagcaagtacttc
gagttccatggcgtgcggctgccgcccttctgccgcgggaagatggaggagatcgccaac
ttcccggtgcggcccagcgacgtgtggatcgtcacctaccccaagtccggcaccagcttg
ctgcaggaggtggtctacttggtgagccagggcgctgaccccgatgagatcggcttgatg
aacatcgacgagcagctcccggtcctggagtacccacagccgggcctggacatcatcaag
gaactgacctctccccgcctcatcaagagccacctgccctaccgctttctgccctctgac
ctccacaatggagactccaaggtcatctatatggctcgcaaccccaaggatctggtggtg
tcttattatcagttccaccgctctctgcggaccatgagctaccgaggcacctttcaagaa
ttctgccggaggtttatgaatgataagctgggctacggctcctggtttgagcacgtgcag
gagttctgggagcaccgcatggactcgaacgtgctttttctcaagtatgaagacatgcat
cgggacctggtgacgatggtggagcagctggccagattcctgggggtgtcctgtgacaag
gcccagctggaagccctgacggagcactgccaccagctggtggaccagtgctgcaacgct
gaggccctgcccgtgggccggggaagagttgggctgtggaaggacatcttcaccgtctcc
atgaatgagaagtttgacttggtgtataaacagaagatgggaaagtgtgacctcacgttt
gacttttatttataa

DBGET integrated database retrieval system