KEGG   Homo sapiens (human): 25831Help
Entry
25831             CDS       T01001                                 

Gene name
HECTD1, EULIR
Definition
(RefSeq) HECT domain E3 ubiquitin protein ligase 1
  KO
K12231  E3 ubiquitin-protein ligase HECTD1 [EC:2.3.2.26]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    25831 (HECTD1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     25831 (HECTD1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  HECT type E3
   25831 (HECTD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HECT BTHB Sad1_UNC MIB_HERC2 Ank_2 Ank_5 Ank_4 Ank Ank_3 F5_F8_type_C
Motif
Other DBs
NCBI-GeneID: 25831
NCBI-ProteinID: NP_056197
HGNC: 20157
Ensembl: ENSG00000092148
Vega: OTTHUMG00000170670
Pharos: Q9ULT8(Tdark)
UniProt: Q9ULT8
Structure
PDB: 

Position
14q12
AA seq 2610 aa AA seqDB search
MADVDPDTLLEWLQMGQGDERDMQLIALEQLCMLLLMSDNVDRCFETCPPRTFLPALCKI
FLDESAPDNVLEVTARAITYYLDVSAECTRRIVGVDGAIKALCNRLVVVELNNRTSRDLA
EQCVKVLELICTRESGAVFEAGGLNCVLTFIRDSGHLVHKDTLHSAMAVVSRLCGKMEPQ
DSSLEICVESLSSLLKHEDHQVSDGALRCFASLADRFTRRGVDPAPLAKHGLTEELLSRM
AAAGGTVSGPSSACKPGRSTTGAPSTTADSKLSNQVSTIVSLLSTLCRGSPVVTHDLLRS
ELPDSIESALQGDERCVLDTMRLVDLLLVLLFEGRKALPKSSAGSTGRIPGLRRLDSSGE
RSHRQLIDCIRSKDTDALIDAIDTGAFEVNFMDDVGQTLLNWASAFGTQEMVEFLCERGA
DVNRGQRSSSLHYAACFGRPQVAKTLLRHGANPDLRDEDGKTPLDKARERGHSEVVAILQ
SPGDWMCPVNKGDDKKKKDTNKDEEECNEPKGDPEMAPIYLKRLLPVFAQTFQQTMLPSI
RKASLALIRKMIHFCSEALLKEVCDSDVGHNLPTILVEITATVLDQEDDDDGHLLALQII
RDLVDKGGDIFLDQLARLGVISKVSTLAGPSSDDENEEESKPEKEDEPQEDAKELQQGKP
YHWRDWSIIRGRDCLYIWSDAAALELSNGSNGWFRFILDGKLATMYSSGSPEGGSDSSES
RSEFLEKLQRARGQVKPSTSSQPILSAPGPTKLTVGNWSLTCLKEGEIAIHNSDGQQATI
LKEDLPGFVFESNRGTKHSFTAETSLGSEFVTGWTGKRGRKLKSKLEKTKQKVRTMARDL
YDDHFKAVESMPRGVVVTLRNIATQLESSWELHTNRQCIESENTWRDLMKTALENLIVLL
KDENTISPYEMCSSGLVQALLTVLNNSMDLDMKQDCSQLVERINVFKTAFSENEDDESRP
AVALIRKLIAVLESIERLPLHLYDTPGSTYNLQILTRRLRFRLERAPGETALIDRTGRML
KMEPLATVESLEQYLLKMVAKQWYDFDRSSFVFVRKLREGQNFIFRHQHDFDENGIIYWI
GTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLEDILSRDNSALNCHSNDDKNAWFAID
LGLWVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPL
DPPKDEKQGWRHVRIKQMGKNASGQTHYLSLSGFELYGTVNGVCEDQLGKAAKEAEANLR
RQRRLVRSQVLKYMVPGARVIRGLDWKWRDQDGSPQGEGTVTGELHNGWIDVTWDAGGSN
SYRMGAEGKFDLKLAPGYDPDTVASPKPVSSTVSGTTQSWSSLVKNNCPDKTSAAAGSSS
RKGSSSSVCSVASSSDISLGSTKTERRSEIVMEHSIVSGADVHEPIVVLSSAENVPQTEV
GSSSSASTSTLTAETGSENAERKLGPDSSVRTPGESSAISMGIVSVSSPDVSSVSELTNK
EAASQRPLSSSASNRLSVSSLLAAGAPMSSSASVPNLSSRETSSLESFVRRVANIARTNA
TNNMNLSRSSSDNNTNTLGRNVMSTATSPLMGAQSFPNLTTPGTTSTVTMSTSSVTSSSN
VATATTVLSVGQSLSNTLTTSLTSTSSESDTGQEAEYSLYDFLDSCRASTLLAELDDDED
LPEPDEEDDENEDDNQEDQEYEEVMILRRPSLQRRAGSRSDVTHHAVTSQLPQVPAGAGS
RPIGEQEEEEYETKGGRRRTWDDDYVLKRQFSALVPAFDPRPGRTNVQQTTDLEIPPPGT
PHSELLEEVECTPSPRLALTLKVTGLGTTREVELPLTNFRSTIFYYVQKLLQLSCNGNVK
SDKLRRIWEPTYTIMYREMKDSDKEKENGKMGCWSIEHVEQYLGTDELPKNDLITYLQKN
ADAAFLRHWKLTGTNKSIRKNRNCSQLIAAYKDFCEHGTKSGLNQGAISTLQSSDILNLT
KEQPQAKAGNGQNSCGVEDVLQLLRILYIVASDPYSRISQEDGDEQPQFTFPPDEFTSKK
ITTKILQQIEEPLALASGALPDWCEQLTSKCPFLIPFETRQLYFTCTAFGASRAIVWLQN
RREATVERTRTTSSVRRDDPGEFRVGRLKHERVKVPRGESLMEWAENVMQIHADRKSVLE
VEFLGEEGTGLGPTLEFYALVAAEFQRTDLGAWLCDDNFPDDESRHVDLGGGLKPPGYYV
QRSCGLFTAPFPQDSDELERITKLFHFLGIFLAKCIQDNRLVDLPISKPFFKLMCMGDIK
SNMSKLIYESRGDRDLHCTESQSEASTEEGHDSLSVGSFEEDSKSEFILDPPKPKPPAWF
NGILTWEDFELVNPHRARFLKEIKDLAIKRRQILSNKGLSEDEKNTKLQELVLKNPSGSG
PPLSIEDLGLNFQFCPSSRIYGFTAVDLKPSGEDEMITMDNAEEYVDLMFDFCMHTGIQK
QMEAFRDGFNKVFPMEKLSSFSHEEVQMILCGNQSPSWAAEDIINYTEPKLGYTRDSPGF
LRFVRVLCGMSSDERKAFLQFTTGCSTLPPGGLANLHPRLTVVRKVDATDASYPSVNTCV
HYLKLPEYSSEEIMRERLLAATMEKGFHLN
NT seq 7833 nt NT seq  +upstreamnt  +downstreamnt
atggcagatgtggacccagatacattgctggaatggctacagatgggacagggagatgaa
agggacatgcaactaatagcccttgaacagctatgcatgctgcttttgatgtctgacaac
gtggatcgttgttttgaaacatgtcctcctcgcactttcttaccagccctttgcaaaatt
tttcttgatgaaagtgctccagacaatgtattagaggtgacagcccgtgccataacatac
tacctggatgtatctgcggaatgtacccgaaggattgttggggtagatggagctataaaa
gcactttgtaatcgtttggttgtagttgaacttaacaacaggactagcagagacttagcc
gaacagtgtgtaaaggtattagaactgatatgtactcgtgagtcaggagcagtctttgag
gctggtggtttgaattgtgtgcttaccttcattcgtgacagtggacatctagttcataaa
gacaccttgcactctgctatggctgtggtatcaagactctgtggcaaaatggagcctcaa
gattcttctttagaaatttgtgtagaatctctgtctagtttattaaagcatgaagatcat
caggtttcagatggagctctgcgatgctttgcatcactggctgaccgatttacccgtcgt
ggtgttgacccagctccattagccaagcatggattaactgaggagctgttatctcgaatg
gctgctgctggtggtactgtttcaggaccatcatcagcatgcaaaccaggtcgcagcacc
acaggagctccatccaccactgcagattccaaattgagtaatcaggtgtcaacaattgta
agtctgctctcaacactttgcagaggctctccggtagtaacacatgatcttctgaggtcg
gagcttccagattcaattgaaagtgcattgcagggtgatgaaagatgtgtgcttgatact
atgcgtttggttgaccttctcttggtgctattatttgaaggacgaaaagctttgccaaag
tctagtgctggatctacaggcagaatcccaggactccggagattagatagttctggggag
cgctcacatcggcagcttatagattgtattcgaagtaaagataccgatgcacttatagat
gcaattgacacaggagcctttgaagtaaattttatggatgatgtaggtcagactctatta
aactgggcctctgcttttggaactcaggaaatggtagaatttctttgtgagagaggtgca
gatgttaatagaggtcaaaggtcatcatcattacattatgctgcatgttttggaagacct
caagtagcaaagactctgttacggcatggtgcaaatccagatctgagagatgaagatggg
aaaactccattagataaagctcgagaaaggggccatagtgaagtggtagctattcttcag
tctccaggtgattggatgtgtccagttaataaaggagatgataagaaaaagaaagataca
aacaaagatgaagaagaatgtaatgagcccaaaggagatccggaaatggcacccatatac
ttgaaaaggttattgccagtgtttgcacaaacatttcagcaaactatgctgccttcaata
aggaaagcaagtcttgctctaattcgaaaaatgattcatttttgctctgaagcactgtta
aaagaagtttgtgattctgatgttggtcacaatttgcctacaatactagtggaaatcact
gcaactgtcctggatcaagaggatgatgatgatggccacttgctggctttgcagatcata
agggatttagtagataaaggtggtgatatatttttggatcagctagccagacttggtgta
attagcaaagtgtcaacgttggcaggtccttcctctgatgatgagaatgaagaggaatca
aaaccagaaaaagaagatgaaccacaggaagatgctaaagaattgcaacaaggtaaacca
tatcattggagagactggtcaatcattaggggaagggactgcttatatatttggagtgat
gcagcagccttggaattatctaatggcagtaatggatggttcagatttatcttggatgga
aaacttgccaccatgtattcaagtggtagtccggaaggtggatctgacagttcagaaagc
cgaagtgaattcttagagaagttacaaagagctcgaggccaagtaaagccatctacttca
agtcaacctatactgtcagcaccaggacccactaaacttactgtaggaaattggtcactg
acatgtttgaaagaaggagaaattgctattcataattcagatggtcagcaagctacaata
ttgaaagaagatttacctggttttgtatttgaatctaatagaggaaccaaacattcattt
actgcagaaacttccctgggttcagaatttgtgactggctggactggcaaaagaggcaga
aaactgaaatctaagttagaaaaaacaaagcaaaaggtacgaactatggctcgagattta
tacgatgaccattttaaagctgttgaaagcatgcctcgtggagtagtggtaacactcaga
aacatagcaactcagttagagtcatcttgggaacttcatacaaatagacaatgtattgag
agtgagaacacttggagagatttaatgaagacagctttagaaaacctaattgtacttttg
aaggatgaaaacacaatttcaccatatgaaatgtgtagcagtggcttggtacaagcactt
cttactgtgttaaacaatagcatggatttggatatgaaacaagattgtagtcaactggta
gaaagaataaatgtttttaaaactgcctttagtgaaaatgaagatgatgaaagtcgacca
gcagttgcgttaattcgaaagttaatagctgtactagaatctattgaacgtctacctctc
catttgtatgatacaccaggatccacatataacctccagatacttacaaggagattacga
tttcggttggaacgtgcacctggtgaaactgcattgattgacaggactggcagaatgttg
aagatggaacctttggctacagttgaatctctggaacagtaccttttgaaaatggtagca
aaacagtggtatgattttgaccgatcttcatttgtttttgttcgaaaattaagagaagga
caaaattttatatttcggcaccagcatgattttgatgaaaatggaatcatttactggatt
ggaacaaatgcaaaaactgcttatgaatgggtaaatccagctgcctatggacttgtagta
gtaacgtcatcagaaggaagaaatctaccttatggccgcttagaagacatactaagtcgt
gataattcagctttaaattgtcatagcaatgatgataagaatgcctggtttgccatagat
ctgggtctctgggtgataccatcagcatatacacttcgtcatgctcgtggttatggaagg
tctgcactgagaaattgggttttccaggtatccaaagatggacagaactggacttctttg
tatacccatgttgatgactgcagtctcaatgaaccagggtcaactgcaacttggcctctt
gatccaccaaaggatgagaaacaagggtggagacatgtgagaattaaacagatggggaaa
aatgccagtggacaaacacactacctctcattatctggattcgaactttatggcactgta
aatggagtatgtgaagatcagctagggaaagcagctaaagaagcagaagctaatcttaga
cggcagagacgtctagtacgttcccaggttctgaaatacatggttccaggagctcgtgtt
atcagaggcctggattggaaatggcgagatcaggatggcagcccacagggagaaggcact
gtcacaggagaactacacaatggctggattgatgtcacctgggatgctggtggctcaaac
tcttaccgtatgggcgcagaaggaaaatttgacctcaagcttgcaccagggtacgaccct
gatacagtggcatcacccaaacctgtttcatccactgtttcaggcacaacgcaatcatgg
agcagcttggtgaaaaacaactgtccagacaagacatctgctgctgcaggctcctcaagt
agaaaaggaagcagcagttctgtgtgtagcgtggccagtagcagcgacatcagcttgggt
tcgaccaaaacggaacggagatcagaaattgtaatggaacacagtatagtttcaggagct
gatgtccatgaaccaattgttgttctttcatctgctgaaaacgtccctcaaacagaagta
gggtcatcttccagtgcaagcaccagcaccttaacagcggaaacgggaagtgaaaatgct
gaaaggaagttaggccctgatagttctgttcgtactcctggggagtctagtgcaatatcc
atgggaattgtcagtgttagttctcctgatgttagttcagtatctgaattaactaataaa
gaagcagcttcacaacgacctcttagctcttcagcaagtaacagactgtcagtgagttct
ttgttggctgctggggcccctatgagctctagtgcaagtgtacctaacctgtcctcaaga
gaaacatctagcttggagagttttgtaaggagagtggcaaacatagcacggactaatgcc
acgaacaacatgaatctaagccgaagcagcagtgataacaacactaatactttggggagg
aatgtgatgagcacagcaacttctcctcttatgggtgctcagagtttccctaatttgacc
acacctggtactacatcaacagtgactatgtcaacatccagtgttactagcagcagcaat
gtagctacagcaacaacagttttatcagttggtcaatctttaagtaacactttaaccacc
agcctcacatcaacttccagtgagagtgacacaggtcaggaagcagaatattccttatat
gatttccttgatagctgccgtgccagtactctattggctgagctcgatgatgatgaggac
ttacctgagccagatgaagaagatgatgagaatgaagatgacaatcaggaggaccaagaa
tacgaggaggttatgattctgagacgcccatccctgcaacgtcgagctggctcccgctct
gatgtaacgcatcatgctgttacctcgcagctaccacaggtacctgctggagcagggagc
cgacctattggggagcaggaagaagaagagtacgaaactaaaggaggacgccggagaaca
tgggatgatgattatgtgctaaagagacagttttctgcattggttcctgcttttgatcct
agacctggtcgtactaatgtccagcagacaactgatctagaaataccacccccagggacc
cctcattcagagctcttggaagaagtcgaatgtactccgtcacctcgattagctctcact
ttgaaagtaacaggtcttggaacgactcgtgaagttgaattaccactcaccaatttcaga
tcaaccatcttttactatgtacaaaaattgcttcaattgtcctgtaatggcaatgtgaaa
tcagataaacttaggcgtatttgggagcccacatacacaatcatgtacagagaaatgaag
gattctgataaagaaaaggaaaatggaaaaatgggttgctggtctatagagcatgtggag
cagtaccttggcactgatgaattaccaaagaatgacttgataacctacctgcagaagaat
gcagacgctgctttcctgcgccactggaaattaactggcactaataaaagtattaggaaa
aacagaaattgttctcagctcatagctgcatataaggatttttgtgagcatggaacaaag
tctgggttaaaccagggggccatttctactcttcaaagtagtgatattcttaatttaaca
aaagaacaacctcaggccaaagcaggcaatggacagaactcttgtggagtagaagatgtc
cttcagcttctgcgtattctatatatagttgcaagtgacccttattcaagaatatcccag
gaagatggtgatgaacagcctcagtttacttttccaccagatgaattcactagcaaaaaa
attacaacaaaaatattacagcagattgaggaaccattggcactggcaagtggggctctg
ccagactggtgtgaacaattaaccagcaaatgtccttttctaataccatttgaaactaga
cagctttatttcacatgtacagcatttggcgcctcaagagcaatagtatggttacagaac
cgacgtgaagccactgtggagcgaacgagaaccacaagcagtgttaggcgagatgaccct
ggagagtttcgagttggtcgtctcaagcatgaaagagtaaaagttccacgtggcgagtca
ctgatggaatgggctgagaatgtcatgcaaatacatgcagatcggaaatcagttcttgag
gttgaatttttaggagaagaaggaactggcttgggacccacattagagttttatgctctg
gtggcagcagaattccagagaactgacttgggagcttggctttgtgatgataattttcca
gatgatgaatctcgtcacgttgatcttggaggtggattgaaacctcctggatattatgtg
cagaggtcatgtggactgttcacagcaccatttccacaggatagtgatgagcttgaaagg
atcacgaaactgtttcatttccttggaattttcttggccaaatgcattcaagacaataga
cttgtggacttacctatttctaaacctttttttaaacttatgtgtatgggtgacattaaa
agcaatatgagtaaactgatttatgagtcacgaggtgatagagacttacactgtactgaa
agtcagtctgaagcttctacagaagaaggtcatgattcactctcggtaggaagctttgaa
gaggattcaaaatcagaatttattcttgatccccctaaaccaaaacccccagcttggttt
aatggaattttgacttgggaagactttgaattagtaaacccacacagagccagattttta
aaagaaattaaagaccttgctatcaagaggcgccaaattttaagcaacaaaggtctttct
gaagatgagaagaacacaaaattacaggaactagtgctgaagaatccatcaggttctggg
cctccacttagcatagaggatttaggtttaaatttccagttttgcccttcctcaagaata
tatggttttacagctgtggatctcaagccaagtggtgaagatgagatgataacaatggat
aatgcagaagaatatgtggatttgatgtttgacttttgtatgcatacgggtattcagaaa
caaatggaagcctttagagatgggtttaataaagtttttccaatggagaaattaagttcc
ttcagccatgaagaagtccaaatgattctttgtggaaaccagtcaccatcctgggcagca
gaggatattatcaattacactgaacctaagctgggttatacacgtgacagccctggtttc
ctgaggtttgtgagggttttatgtggcatgtcttctgatgaaaggaaagcattcttgcag
tttaccactggttgttcaactctacccccaggtggactggctaacctgcatcccaggctc
acggttgtacgcaaggttgatgctactgatgcaagctatccatcagtcaatacatgtgtg
cattaccttaagttgcctgaatattcttccgaggagatcatgagagagcgcctgctagct
gctacaatggagaaaggctttcatctcaattga

DBGET integrated database retrieval system