KEGG   Homo sapiens (human): 25837Help
Entry
25837             CDS       T01001                                 

Gene name
RAB26, V46133
Definition
(RefSeq) RAB26, member RAS oncogene family
  KO
K07913  Ras-related protein Rab-26
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    25837 (RAB26)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    25837 (RAB26)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    25837 (RAB26)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab26/37
    25837 (RAB26)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf Gtr1_RagA RsgA_GTPase MMR_HSR1 SRPRB Septin GTP_EFTU PduV-EutP FeoB_N AAA_16 AAA_24 AAA_22 AsnC_trans_reg2
Motif
Other DBs
NCBI-GeneID: 25837
NCBI-ProteinID: NP_055168
OMIM: 605455
HGNC: 14259
Ensembl: ENSG00000167964
Vega: OTTHUMG00000128829
Pharos: Q9ULW5(Tbio)
UniProt: Q9ULW5
Structure
PDB: 

Position
16p13.3
AA seq 256 aa AA seqDB search
MSRKKTPKSKGASTPAASTLPTANGARPARSGTALSGPDAPPNGPLQPGRPSLGGGVDFY
DVAFKVMLVGDSGVGKTCLLVRFKDGAFLAGTFISTVGIDFRNKVLDVDGVKVKLQMWDT
AGQERFRSVTHAYYRDAHALLLLYDVTNKASFDNIQAWLTEIHEYAQHDVALMLLGNKVD
SAHERVVKREDGEKLAKEYGLPFMETSAKTGLNVDLAFTAIAKELKQRSMKAPSEPRFRL
HDYVKREGRGASCCRP
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgtccaggaagaagacccccaagagcaaaggggccagcacccccgctgcctccacgctg
cccaccgccaacggggcccgaccggcgcgctccgggactgcgctttccggccccgacgcg
ccgcccaacgggcccttgcagcccggccggccctcgcttggcggcggtgtcgacttctac
gacgtcgccttcaaggtcatgctggtgggggactcgggtgtggggaagacctgtctgctg
gtgcgattcaaggatggtgctttcctggcggggaccttcatctccaccgtaggcattgac
ttccggaacaaagttctggacgtggatggtgtgaaggtgaagctgcagatgtgggacaca
gctggtcaggagcggttccgcagtgttacccatgcctactaccgggatgctcatgctctg
ctgctgctctacgatgtcaccaacaaggcctcctttgacaacatccaggcctggctgacc
gagatccacgagtacgcccagcacgacgtggcgctcatgctgctggggaacaaggtggac
tctgcccatgagcgtgtggtgaagagggaggacggggagaagctggccaaggagtatgga
ctgcccttcatggagaccagcgccaagacgggcctcaacgtggacttggccttcacagcc
atagcaaaggagttgaagcagcgctccatgaaggctcccagcgagccgcgcttccggctg
catgattacgttaagagggagggtcgaggggcctcctgctgccgcccttga

DBGET integrated database retrieval system