KEGG   Homo sapiens (human): 2584Help
Entry
2584              CDS       T01001                                 

Gene name
GALK1, GALK, GK1, HEL-S-19
Definition
(RefSeq) galactokinase 1
  KO
K00849  galactokinase [EC:2.7.1.6]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00052  Galactose metabolism
hsa00520  Amino sugar and nucleotide sugar metabolism
hsa01100  Metabolic pathways
Module
hsa_M00554  Nucleotide sugar biosynthesis, galactose => UDP-galactose
hsa_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Network
nt06023  Galactose degradation
  Element
N00847  Galactose degradation
N00848  GALE deficiency in galactose degradation
N00849  GALT deficiency in galactose degradation
N00850  GALK1 deficiency in galactose degradation
Disease
H00070  Galactosemia
H02009  Galactokinase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    2584 (GALK1)
   00520 Amino sugar and nucleotide sugar metabolism
    2584 (GALK1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2584 (GALK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.6  galactokinase
     2584 (GALK1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   2584 (GALK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GalKase_gal_bdg GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-GeneID: 2584
NCBI-ProteinID: NP_000145
OMIM: 604313
HGNC: 4118
Ensembl: ENSG00000108479
Vega: OTTHUMG00000179832
Pharos: P51570(Tchem)
UniProt: P51570 V9HWE7
Structure
PDB: 

Position
17q25.1
AA seq 392 aa AA seqDB search
MAALRQPQVAELLAEARRAFREEFGAEPELAVSAPGRVNLIGEHTDYNQGLVLPMALELM
TVLVGSPRKDGLVSLLTTSEGADEPQRLQFPLPTAQRSLEPGTPRWANYVKGVIQYYPAA
PLPGFSAVVVSSVPLGGGLSSSASLEVATYTFLQQLCPDSGTIAARAQVCQQAEHSFAGM
PCGIMDQFISLMGQKGHALLIDCRSLETSLVPLSDPKLAVLITNSNVRHSLASSEYPVRR
RQCEEVARALGKESLREVQLEELEAARDLVSKEGFRRARHVVGEIRRTAQAAAALRRGDY
RAFGRLMVESHRSLRDDYEVSCPELDQLVEAALAVPGVYGSRMTGGGFGGCTVTLLEASA
APHAMRHIQEHYGGTATFYLSQAADGAKVLCL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggctgctttgagacagccccaggtcgcggagctgctggccgaggcccggcgagccttc
cgggaggagttcggggccgagcccgagctggccgtgtcagcgccgggccgcgtcaacctc
atcggggaacacacggactacaaccagggcctggtgctgcctatggctctggagctcatg
acggtgctggtgggcagcccccgcaaggatgggctggtgtctctcctcaccacctctgag
ggtgccgatgagccccagcggctgcagtttccactgcccacagcccagcgctcgctggag
cctgggactcctcggtgggccaactatgtcaagggagtgattcagtactacccagctgcc
cccctccctggcttcagtgcagtggtggtcagctcagtgcccctggggggtggcctgtcc
agctcagcatccttggaagtggccacgtacaccttcctccagcagctctgtccagactcg
ggcacaatagctgcccgcgcccaggtgtgtcagcaggccgagcacagcttcgcagggatg
ccctgtggcatcatggaccagttcatctcacttatgggacagaaaggccacgcgctgctc
attgactgcaggtccttggagaccagcctggtgccactctcggaccccaagctggccgtg
ctcatcaccaactctaatgtccgccactccctggcctccagcgagtaccctgtgcggcgg
cgccaatgtgaagaagtggcccgggcgctgggcaaggaaagcctccgggaggtacaactg
gaagagctagaggctgccagggacctggtgagcaaagagggcttccggcgggcccggcac
gtggtgggggagattcggcgcacggcccaggcagcggccgccctgagacgtggcgactac
agagcctttggccgcctcatggtggagagccaccgctcactcagagacgactatgaggtg
agctgcccagagctggaccagctggtggaggctgcgcttgctgtgcctggggtttatggc
agccgcatgacgggcggtggcttcggtggctgcacggtgacactgctggaggcctccgct
gctccccacgccatgcggcacatccaggagcactacggcgggactgccaccttctacctc
tctcaagcagccgatggagccaaggtgctgtgcttgtga

DBGET integrated database retrieval system