KEGG   Homo sapiens (human): 25842Help
Entry
25842             CDS       T01001                                 

Gene name
ASF1A, CGI-98, CIA, HSPC146
Definition
(RefSeq) anti-silencing function 1A histone chaperone
  KO
K10753  histone chaperone ASF1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    25842 (ASF1A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histone chaperones
    Other Histone chaperones and regulators
     25842 (ASF1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ASF1_hist_chap UPF0154
Motif
Other DBs
NCBI-GeneID: 25842
NCBI-ProteinID: NP_054753
OMIM: 609189
HGNC: 20995
Ensembl: ENSG00000111875
Vega: OTTHUMG00000015470
Pharos: Q9Y294(Tchem)
UniProt: Q9Y294
Structure
PDB: 

Position
6q22.31
AA seq 204 aa AA seqDB search
MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSV
LVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTET
ELRENPPVKPDFSKLQRNILASNPRVTRFHINWEDNTEKLEDAESSNPNLQSLLSTDALP
SASKGWSTSENSLNVMLESHMDCM
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggttcaggtgaacaatgtagtggtgctggataacccttctcctttctacaac
ccgttccagttcgagatcaccttcgagtgcatcgaggacctgtctgaagacttggaatgg
aaaattatctatgtgggctctgcagaaagtgaagaatacgatcaagttttagactctgtt
ttagtgggtcctgttcccgcaggaaggcatatgtttgtatttcaggctgatgcacctaat
ccaggactcattccagatgcagatgcagtaggcgtaactgttgtgctaattacttgtacc
tatcgaggacaagaatttattagagttggctattatgtaaataatgaatatactgagaca
gaattaagggaaaatccaccagtaaaaccagacttttctaagcttcaaaggaatattttg
gcatctaatcccagggtcacaagattccacattaattgggaagataacacagaaaaactg
gaagatgcagagagcagtaatccaaatctacagtcacttctttcaacagatgcattacct
tcagcatcaaagggatggtccacatcagaaaactcactaaatgtcatgttagaatcccac
atggactgcatgtga

DBGET integrated database retrieval system