KEGG   Homo sapiens (human): 25847
Entry
25847             CDS       T01001                                 

Gene name
ANAPC13, APC13, SWM1
Definition
(RefSeq) anaphase promoting complex subunit 13
  KO
K12456  anaphase-promoting complex subunit 13
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04914  Progesterone-mediated oocyte maturation
Network
nt06130  Cell cycle (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle G1/S
  Element
N00221  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    25847 (ANAPC13)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    25847 (ANAPC13)
   04114 Oocyte meiosis
    25847 (ANAPC13)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    25847 (ANAPC13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    25847 (ANAPC13)
   03036 Chromosome and associated proteins [BR:hsa03036]
    25847 (ANAPC13)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     25847 (ANAPC13)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    25847 (ANAPC13)
SSDB
Motif
Pfam: Apc13p
Other DBs
NCBI-GeneID: 25847
NCBI-ProteinID: NP_001229303
OMIM: 614484
HGNC: 24540
Ensembl: ENSG00000129055
Vega: OTTHUMG00000159803
Pharos: Q9BS18(Tbio)
UniProt: Q9BS18 A8K3Z6
Structure
PDB: 

Position
3q22.2
AA seq 74 aa
MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDL
ALQYLHENVPPIGN
NT seq 225 nt   +upstreamnt  +downstreamnt
atggacagtgaggttcagagagatggaaggatcttggatttgattgatgatgcttggcga
gaagacaagctgccttatgaggatgtcgcaataccactgaatgagcttcctgaacctgaa
caagacaatggtggcaccacagaatctgtcaaagaacaagaaatgaagtggacagactta
gccttacagtacctccatgagaatgttccccccattggaaactga

DBGET integrated database retrieval system