KEGG   Homo sapiens (human): 25852Help
Entry
25852             CDS       T01001                                 

Gene name
ARMC8, GID5, HSPC056, S863-2, VID28
Definition
(RefSeq) armadillo repeat containing 8
  KO
K23336  armadillo repeat-containing protein 8
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    25852 (ARMC8)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   CTLH complex
    25852 (ARMC8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm HEAT HEAT_EZ V-ATPase_H_C ParcG
Motif
Other DBs
NCBI-GeneID: 25852
NCBI-ProteinID: NP_056211
HGNC: 24999
Ensembl: ENSG00000114098
Vega: OTTHUMG00000159821
Pharos: Q8IUR7(Tbio)
UniProt: Q8IUR7
Position
3q22.3
AA seq 659 aa AA seqDB search
MEVTASSRHYVDRLFDPDPQKVLQGVIDMKNAVIGNNKQKANLIVLGAVPRLLYLLQQET
SSTELKTECAVVLGSLAMGTENNVKSLLDCHIIPALLQGLLSPDLKFIEACLRCLRTIFT
SPVTPEELLYTDATVIPHLMALLSRSRYTQEYICQIFSHCCKGPDHQTILFNHGAVQNIA
HLLTSLSYKVRMQALKCFSVLAFENPQVSMTLVNVLVDGELLPQIFVKMLQRDKPIEMQL
TSAKCLTYMCRAGAIRTDDNCIVLKTLPCLVRMCSKERLLEERVEGAETLAYLIEPDVEL
QRIASITDHLIAMLADYFKYPSSVSAITDIKRLDHDLKHAHELRQAAFKLYASLGANDED
IRKKIIETENMMDRIVTGLSESSVKVRLAAVRCLHSLSRSVQQLRTSFQDHAVWKPLMKV
LQNAPDEILVVASSMLCNLLLEFSPSKEPILESGAVELLCGLTQSENPALRVNGIWALMN
MAFQAEQKIKADILRSLSTEQLFRLLSDSDLNVLMKTLGLLRNLLSTRPHIDKIMSTHGK
QIMQAVTLILEGEHNIEVKEQTLCILANIADGTTAKDLIMTNDDILQKIKYYMGHSHVKL
QLAAMFCISNLIWNEEEGSQERQDKLRDMGIVDILHKLSQSPDSNLCDKAKMALQQYLA
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggaagtaacagctagcagtcgccactatgttgacaggctatttgaccctgatccccag
aaagttctacaaggtgtcatagacatgaaaaatgctgtaattggaaacaacaagcagaaa
gccaatctcattgttttaggagctgttccaagattgttgtacttgcttcagcaagaaacc
tcaagcacagagctgaaaactgaatgtgcagtggtgttgggaagtcttgctatgggtact
gaaaacaatgtcaagtctctactggactgccatattatccctgccttattgcaaggacta
ctgtccccagacctgaagtttattgaagcttgcctccgatgcctgcgtaccatcttcacc
agtcctgtcactccagaggagctactgtatacagatgccacagtgataccacacctcatg
gcactgcttagcaggtcccgctatacccaggagtacatctgtcagatcttctcacactgc
tgtaaagggccagatcatcaaacaattttatttaaccacggtgcagttcagaatattgct
cacctactaacctcactgtcctacaaagttcgaatgcaagcactgaaatgtttctcagtt
ttagcttttgaaaacccccaggtatcgatgaccctggtaaatgttttggttgatggagaa
ttgttaccacagatttttgtgaagatgttacagagggataagcctattgagatgcagctc
acatcagcaaaatgtttaacttacatgtgtagagctggagcaattcggacagatgataac
tgtattgtattaaagacattaccttgtttggttcgaatgtgcagtaaggagagattacta
gaggagagagttgaaggagctgagacacttgcctatctgattgaaccagatgttgagcta
cagagaatcgctagcataactgatcacctcattgccatgcttgctgattatttcaagtat
cccagctcagtgagtgccatcactgatattaaaaggcttgatcatgatttaaaacatgct
cacgaactccgccaggctgcattcaagctctatgcctctcttggagcaaatgatgaagac
atccggaagaagatcattgagactgaaaatatgatggaccgaattgtgactggcttgtct
gagtctagtgtcaaggtgcggttagctgccgtcagatgtttgcacagtttatccagatct
gtgcagcagcttcgaaccagtttccaggatcatgctgtttggaaacctttaatgaaggtt
ttacaaaatgcaccagatgaaatcctagtggtagcatcttccatgctgtgtaatcttctt
cttgaattttctccaagcaaagagccaattttggaatcaggagccgtagagctactttgt
ggattaactcagagtgaaaatcctgctttacgagtgaatggaatttgggctttaatgaat
atggcatttcaggctgaacaaaaaataaaagcagatattttacgaagcttgagtactgaa
cagctattccggttattatcagattcagatttgaatgtgctgatgaagacattgggactt
cttagaaatctcctctccactcgtcctcatatagataaaataatgagtactcatggaaag
caaattatgcaagccgtcactcttattctagaaggggaacataacattgaggtcaaagag
cagacactgtgcatcttagccaacatagcggatgggacaacagcaaaagatcttattatg
accaatgatgatatcctacagaaaatcaagtattacatgggccattcacatgttaaactg
cagcttgcagccatgttttgtatatcaaacctcatatggaatgaagaggaaggttcacaa
gaacgccaggataaattacgagacatgggcatcgtagatattctacacaaactgagtcag
tcaccagattcaaacctttgtgacaaggcaaagatggcactgcagcagtacctggcatga

DBGET integrated database retrieval system