KEGG   Homo sapiens (human): 25853Help
Entry
25853             CDS       T01001                                 

Gene name
DCAF12, CT102, KIAA1892, TCC52, WDR40A
Definition
(RefSeq) DDB1 and CUL4 associated factor 12
  KO
K11803  DDB1- and CUL4-associated factor 12
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    25853 (DCAF12)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     25853 (DCAF12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40_like
Motif
Other DBs
NCBI-GeneID: 25853
NCBI-ProteinID: NP_056212
HGNC: 19911
Ensembl: ENSG00000198876
Vega: OTTHUMG00000019806
Pharos: Q5T6F0(Tdark)
UniProt: Q5T6F0
Position
9p13.3
AA seq 453 aa AA seqDB search
MARKVVSRKRKAPASPGAGSDAQGPQFGWDHSLHKRKRLPPVKRSLVYYLKNREVRLQNE
TSYSRVLHGYAAQQLPSLLKEREFHLGTLNKVFASQWLNHRQVVCGTKCNTLFVVDVQTS
QITKIPILKDREPGGVTQQGCGIHAIELNPSRTLLATGGDNPNSLAIYRLPTLDPVCVGD
DGHKDWIFSIAWISDTMAVSGSRDGSMGLWEVTDDVLTKSDARHNVSRVPVYAHITHKAL
KDIPKEDTNPDNCKVRALAFNNKNKELGAVSLDGYFHLWKAENTLSKLLSTKLPYCRENV
CLAYGSEWSVYAVGSQAHVSFLDPRQPSYNVKSVCSRERGSGIRSVSFYEHIITVGTGQG
SLLFYDIRAQRFLEERLSACYGSKPRLAGENLKLTTGKGWLNHDETWRNYFSDIDFFPNA
VYTHCYDSSGTKLFVAGGPLPSGLHGNYAGLWS
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggcccggaaagtagttagcaggaagcggaaagcgcccgcctcgccgggagctgggagc
gacgctcagggcccgcagtttggctgggatcactcgcttcacaaaaggaaaagacttcct
cctgtgaagagatccttagtatactacttgaagaaccgggaagtcaggctacagaatgaa
accagctactctcgagtgttgcatggttatgcagcacagcaacttcccagtctcctgaag
gagagagagtttcaccttgggacccttaataaagtgtttgcatctcagtggttgaatcat
aggcaagtggtgtgtggcacaaaatgcaacacgctatttgtcgtagatgtccagacaagc
cagatcaccaagatccccattctgaaagaccgggagcctggaggtgtgacccagcagggc
tgtggtatccatgccatcgagctgaatccttctagaacactgctagccactggaggagac
aaccccaacagtcttgccatctatcgactacctacgctggatcctgtgtgtgtaggagat
gatggacacaaggactggatcttttccatcgcatggatcagcgacactatggcagtgtct
ggctcacgtgatggttctatgggactctgggaggtgacagatgatgttttgaccaaaagt
gatgcgagacacaatgtgtcacgggtccctgtgtatgcacacatcactcacaaggcctta
aaggacatccccaaagaagacacaaaccctgacaactgcaaggttcgggctctggccttc
aacaacaagaacaaggaactgggagcagtgtctctggatggctactttcatctctggaag
gctgaaaatacactatctaagctcctctccaccaaactgccatattgccgtgagaatgtg
tgtctggcttatggtagtgaatggtcagtttatgcagtgggctcccaagctcatgtctcc
ttcttggatccacggcagccatcatacaacgtcaagtctgtctgttccagggagcgaggc
agtggaatccggtcagtgagtttctacgagcacatcatcactgtgggaacagggcagggc
tccctgctgttctatgacatccgagctcagagatttctggaagagaggctctcagcttgt
tatgggtccaagcccagactagcaggggagaatctgaaactaaccactggcaaaggctgg
ctgaatcatgatgaaacctggaggaattacttttcagacattgacttcttccccaatgct
gtttacacccactgctacgactcgtctggaacgaaactctttgtggcaggaggtcccctc
ccttcagggctccatggaaactatgctgggctctggagttaa

DBGET integrated database retrieval system