KEGG   Homo sapiens (human): 25855
Entry
25855             CDS       T01001                                 

Gene name
BRMS1
Definition
(RefSeq) BRMS1 transcriptional repressor and anoikis regulator
  KO
K19196  breast cancer metastasis-suppressor 1 and related proteins
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    25855 (BRMS1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HDAC complexes
    Sin3A-HDAC complex
     25855 (BRMS1)
SSDB
Motif
Pfam: Sds3 Dynactin_p62
Other DBs
NCBI-GeneID: 25855
NCBI-ProteinID: NP_056214
OMIM: 606259
HGNC: 17262
Ensembl: ENSG00000174744
Vega: OTTHUMG00000167081
Pharos: Q9HCU9(Tbio)
UniProt: Q9HCU9
Structure
PDB: 
2XUS 4AUV

Position
11q13.2
AA seq 246 aa
MPVQPPSKDTEEMEAEGDSAAEMNGEEEESEEERSGSQTESEEESSEMDDEDYERRRSEC
VSEMLDLEKQFSELKEKLFRERLSQLRLRLEEVGAERAPEYTEPLGGLQRSLKIRIQVAG
IYKGFCLDVIRNKYECELQGAKQHLESEKLLLYDTLQGELQERIQRLEEDRQSLDLSSEW
WDDKLHARGSSRSWDSLPPSKRKKAPLVSGPYIVYMLQEIDILEDWTAIKKARAAVSPQK
RKSDGP
NT seq 741 nt   +upstreamnt  +downstreamnt
atgcctgtccagcctccaagcaaagacacagaagagatggaagcagagggtgattctgct
gctgagatgaatggggaggaggaagagagtgaggaggagcggagcggcagccagacagag
tcagaagaggagagctccgagatggatgatgaggactatgagcgacgccgcagcgagtgt
gtcagtgagatgctggacctagagaagcagttctcggagctaaaggagaagttgttcagg
gaacgactgagtcagctgcggttgcggctggaggaagtgggggctgagagagcccctgaa
tacacggagccccttggggggctgcagcggagcctcaagattcgcattcaggtggcaggg
atctacaagggcttctgtctggatgtgatcaggaataagtacgaatgtgagctgcaggga
gccaaacagcacctggagagtgagaagctgctgctctatgacacgctgcagggggagctg
caggagcggatccagaggctggaggaggaccgccagagcctggacctcagctctgaatgg
tgggatgacaaactgcacgccagaggcagctccaggtcttgggactccctgccgcccagc
aagaggaagaaggcacctctggtttctggcccatacatcgtgtacatgcttcaagagatc
gacatcctggaggactggacagccatcaaaaaggctagggcagctgtgtcccctcagaag
agaaaatcggatggaccttga

DBGET integrated database retrieval system