KEGG   Homo sapiens (human): 25862Help
Entry
25862             CDS       T01001                                 

Gene name
USP49
Definition
(RefSeq) ubiquitin specific peptidase 49
  KO
K11834  ubiquitin carboxyl-terminal hydrolase 44/49 [EC:3.4.19.12]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    25862 (USP49)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    25862 (USP49)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     25862 (USP49)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   25862 (USP49)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    25862 (USP49)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH zf-UBP UCH_1 zf-UBP_var Peptidase_C98
Motif
Other DBs
NCBI-GeneID: 25862
NCBI-ProteinID: NP_001273483
HGNC: 20078
Ensembl: ENSG00000164663
Vega: OTTHUMG00000014688
Pharos: Q70CQ1(Tbio)
UniProt: Q70CQ1
Position
6p21.1
AA seq 688 aa AA seqDB search
MDRCKHVGRLRLAQDHSILNPQKWCCLECATTESVWACLKCSHVACGRYIEDHALKHFEE
TGHPLAMEVRDLYVFCYLCKDYVLNDNPEGDLKLLRSSLLAVRGQKQDTPVRRGRTLRSM
ASGEDVVLPQRAPQGQPQMLTALWYRRQRLLARTLRLWFEKSSRGQAKLEQRRQEEALER
KKEEARRRRREVKRRLLEELASTPPRKSARLLLHTPRDAGPAASRPAALPTSRRVPAATL
KLRRQPAMAPGVTGLRNLGNTCYMNSILQVLSHLQKFRECFLNLDPSKTEHLFPKATNGK
TQLSGKPTNSSATELSLRNDRAEACEREGFCWNGRASISRSLELIQNKEPSSKHISLCRE
LHTLFRVMWSGKWALVSPFAMLHSVWSLIPAFRGYDQQDAQEFLCELLHKVQQELESEGT
TRRILIPFSQRKLTKQVLKVVNTIFHGQLLSQVTCISCNYKSNTIEPFWDLSLEFPERYH
CIEKGFVPLNQTECLLTEMLAKFTETEALEGRIYACDQCNSKRRKSNPKPLVLSEARKQL
MIYRLPQVLRLHLKRFRWSGRNHREKIGVHVVFDQVLTMEPYCCRDMLSSLDKETFAYDL
SAVVMHHGKGFGSGHYTAYCYNTEGGFWVHCNDSKLNVCSVEEVCKTQAYILFYTQRTVQ
GNARISETHLQAQVQSSNNDEGRPQTFS
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atggatagatgcaaacatgtagggcggttacggctcgcccaggaccactccatcctgaac
cctcagaagtggtgctgcttagagtgtgccaccaccgagtccgtgtgggcctgcctcaag
tgctcccacgtggcctgcggccgctatattgaggaccacgccctgaaacactttgaggag
acgggacacccgctagccatggaagtccgggatctctacgtgttctgttacctgtgcaag
gactacgtgctcaatgataacccagagggggacctgaagctgctaagaagctccctcctg
gcggtccggggccagaaacaggacacgccggtgagacgtgggcggacgctgcggtccatg
gcttcgggtgaggacgtggtcctgccgcagcgcgctcctcagggacagccgcagatgctc
acggctctgtggtaccggcgtcagcgcctgctggccaggacgctgcggctgtggttcgag
aagagctcccggggccaggcgaagctggagcagcggcggcaggaggaggccctggagcgc
aagaaggaggaggcgcggaggcggcggcgcgaggtgaaacggcggctgctggaggagctg
gccagcacccctccgcgcaagagtgcacggctgctcctgcacacgccccgcgacgcgggc
ccggctgcctcgcgccccgccgccctccctacctcacgcagagtgcccgccgccacactc
aagctgcgtcgccagccggccatggccccaggcgtcacgggcctgcgcaacctgggcaac
acctgctacatgaactccatcctccaggtgctcagccacctccagaagttccgagaatgt
ttcctcaaccttgacccttccaaaacggaacatctgtttcccaaagccaccaacgggaag
actcagctttctggcaagccaaccaacagctcggccacggagctgtccttgagaaatgac
agggccgaggcatgcgagcgggagggcttctgctggaacggcagggcctccattagtcgg
agtctggagctcatccagaacaaggagccgagttcaaagcacatttccctctgccgtgaa
ctgcacaccctcttccgagtcatgtggtccgggaagtgggccctagtgtcgcccttcgcc
atgctccactcagtgtggagcctgatccctgccttccgcggctacgaccaacaggacgcg
caggaatttctctgcgagctgctgcacaaggtgcagcaggaactcgagtctgagggcacc
acacgccggatcctcatccccttctcccagaggaagctcaccaaacaggtcttaaaggtg
gtgaataccatatttcatgggcagctgctcagtcaggtcacatgtatatcatgcaattac
aaatccaataccattgagcccttttgggacctatccctggaattccctgaacgctatcac
tgcatagaaaaggggtttgtccctttgaatcaaacagagtgcttgctcactgagatgctg
gccaaattcacagagacagaggccctggaagggagaatctacgcttgtgaccagtgtaac
agcaaacgacgaaaatccaatcccaaaccccttgttctgagtgaagctagaaagcagtta
atgatctacagactacctcaggttctccggctgcaccttaaaagattcaggtggtctggc
cgtaatcatcgagagaagattggggtccatgtcgtctttgaccaggtattaaccatggaa
ccttactgctgcagggacatgctctcctctcttgacaaagagacctttgcctatgatctc
tccgcagtggtcatgcatcacgggaaagggtttggctcaggacactacacagcctattgc
tacaacacagagggaggtttttgggtccactgcaatgactcaaagctgaatgtatgcagt
gtcgaggaagtgtgcaaaacccaggcctacatccttttttacactcaaagaacagtgcag
ggcaatgcaagaatctcagaaacccatctccaagctcaggtgcagtccagcaacaatgat
gaaggcagaccacagacattttcctga

DBGET integrated database retrieval system