KEGG   Homo sapiens (human): 25864
Entry
25864             CDS       T01001                                 

Gene name
ABHD14A, DORZ1
Definition
(RefSeq) abhydrolase domain containing 14A
  KO
K13706  abhydrolase domain-containing protein 14
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    25864 (ABHD14A)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S33
   25864 (ABHD14A)
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 FSH1 DLH
Other DBs
NCBI-GeneID: 25864
NCBI-ProteinID: NP_056222
OMIM: 618771
HGNC: 24538
Ensembl: ENSG00000248487
Vega: OTTHUMG00000157818
Pharos: Q9BUJ0(Tdark)
UniProt: Q9BUJ0
Position
3p21.2
AA seq 271 aa
MVGALCGCWFRLGGARPLIPLGPTVVQTSMSRSQVALLGLSLLLMLLLYVGLPGPPEQTS
CLWGDPNVTVLAGLTPGNSPIFYREVLPLNQAHRVEVVLLHGKAFNSHTWEQLGTLQLLS
QRGYRAVALDLPGFGNSAPSKEASTEAGRAALLERALRDLEVQNAVLVSPSLSGHYALPF
LMRGHHQLHGFVPIAPTSTQNYTQEQFWAVKTPTLILYGELDHILARESLRQLRHLPNHS
VVKLRNAGHACYLHKPQDFHLVLLAFLDHLP
NT seq 816 nt   +upstreamnt  +downstreamnt
atggtcggggcgctgtgcggctgctggttccgcctgggcggggcccgcccgctcatcccg
ttgggcccgactgtggtacagacctccatgagccggtcccaggtagccctgctgggcctg
agtctgctgctcatgctcctactgtatgtggggctgccaggcccccctgagcagacttcc
tgcctctggggagaccccaatgtcacagtcctggctggtctcacccctggcaactcgccc
atcttttaccgcgaggtgctcccactcaaccaggcacacagggtggaggtggtgctgctt
catggaaaggcctttaactctcacacgtgggagcagctgggcacactgcagctactgtca
cagaggggctaccgggccgtggcccttgaccttccaggttttgggaactcggcaccttca
aaggaggcaagcacagaggcagggcgggcagcgctgctggagcgggcgctgcgggacctg
gaggtacagaatgccgtgttggtgagcccctcgctgagtggccactatgccctgcccttc
ctgatgcgaggccaccaccagctacatggatttgtgcccatcgcacccacctccacccag
aactacacccaggagcaattctgggctgtgaagactccaacccttatcctgtatggagag
ctggaccacatcctggctcgagagtcactgcggcagctccgccacctgcccaaccactct
gtggtgaagctacgcaatgcaggccatgcctgttacctccacaagccgcaagacttccac
cttgtcctgcttgccttccttgaccatctaccttga

DBGET integrated database retrieval system