KEGG   Homo sapiens (human): 25865Help
Entry
25865             CDS       T01001                                 

Gene name
PRKD2, HSPC187, PKD2, nPKC-D2
Definition
(RefSeq) protein kinase D2
  KO
K06070  protein kinase D [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04925  Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    25865 (PRKD2)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    25865 (PRKD2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    25865 (PRKD2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     25865 (PRKD2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  PKD family
   25865 (PRKD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr C1_1 C1_2 Kinase-like Kdo zf-RING_9 ABC1 APH
Motif
Other DBs
NCBI-GeneID: 25865
NCBI-ProteinID: NP_001073349
OMIM: 607074
HGNC: 17293
Ensembl: ENSG00000105287
Vega: OTTHUMG00000183431
Pharos: Q9BZL6(Tchem)
UniProt: Q9BZL6
Structure
PDB: 

Position
19q13.32
AA seq 878 aa AA seqDB search
MATAPSYPAGLPGSPGPGSPPPPGGLELQSPPPLLPQIPAPGSGVSFHIQIGLTREFVLL
PAASELAHVKQLACSIVDQKFPECGFYGLYDKILLFKHDPTSANLLQLVRSSGDIQEGDL
VEVVLSASATFEDFQIRPHALTVHSYRAPAFCDHCGEMLFGLVRQGLKCDGCGLNYHKRC
AFSIPNNCSGARKRRLSSTSLASGHSVRLGTSESLPCTAEELSRSTTELLPRRPPSSSSS
SSASSYTGRPIELDKMLLSKVKVPHTFLIHSYTRPTVCQACKKLLKGLFRQGLQCKDCKF
NCHKRCATRVPNDCLGEALINGDVPMEEATDFSEADKSALMDESEDSGVIPGSHSENALH
ASEEEEGEGGKAQSSLGYIPLMRVVQSVRHTTRKSSTTLREGWVVHYSNKDTLRKRHYWR
LDCKCITLFQNNTTNRYYKEIPLSEILTVESAQNFSLVPPGTNPHCFEIVTANATYFVGE
MPGGTPGGPSGQGAEAARGWETAIRQALMPVILQDAPSAPGHAPHRQASLSISVSNSQIQ
ENVDIATVYQIFPDEVLGSGQFGVVYGGKHRKTGRDVAVKVIDKLRFPTKQESQLRNEVA
ILQSLRHPGIVNLECMFETPEKVFVVMEKLHGDMLEMILSSEKGRLPERLTKFLITQILV
ALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAP
EVLLNQGYNRSLDMWSVGVIMYVSLSGTFPFNEDEDINDQIQNAAFMYPASPWSHISAGA
IDLINNLLQVKMRKRYSVDKSLSHPWLQEYQTWLDLRELEGKMGERYITHESDDARWEQF
AAEHPLPGSGLPTDRDLGGACPPQDHDMQGLAERISVL
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgccccctcttatcccgccgggctccctggctctcccgggccggggtctcct
ccgccccccggcggcctagagctgcagtcgccgccaccgctactgccccagatcccggcc
ccgggttccggggtctcctttcacatccagatcgggctgacccgcgagttcgtgctgttg
cccgccgcctccgagctggctcatgtgaagcagctggcctgttccatcgtggaccagaag
ttccctgagtgtggcttctacggcctttacgacaagatcctgcttttcaaacatgacccc
acgtcggccaacctcctgcagctggtgcgctcgtccggagacatccaggagggcgacctg
gtggaggtggtgctgtcggcctcggccaccttcgaggacttccagatccgcccgcacgcc
ctcacggtgcactcctatcgggcgcctgccttctgtgatcactgcggggagatgctcttc
ggcctagtgcgccagggcctcaagtgcgatggctgcgggctgaactaccacaagcgctgt
gccttcagcatccccaacaactgtagtggggcccgcaaacggcgcctgtcatccacgtct
ctggccagtggccactcggtgcgcctcggcacctccgagtccctgccctgcacggctgaa
gagctgagccgtagcaccaccgaactcctgcctcgccgtcccccgtcatcctcttcctcc
tcttctgcctcatcgtatacgggccgccccattgagctggacaagatgctgctctccaag
gtcaaggtgccgcacaccttcctcatccacagctatacacggcccaccgtttgccaggct
tgcaagaaactcctcaagggcctcttccggcagggcctgcaatgcaaagactgcaagttt
aactgtcacaaacgctgcgccacccgcgtccctaatgactgcctgggggaggcccttatc
aatggagatgtgccgatggaggaggccaccgatttcagcgaggctgacaagagcgccctc
atggatgagtcagaggactccggtgtcatccctggctcccactcagagaatgcgctccac
gccagtgaggaggaggaaggcgagggaggcaaggcccagagctccctggggtacatcccc
ctaatgagggtggtgcaatcggtgcgacacacgacgcggaaatccagcaccacgctgcgg
gagggttgggtggttcattacagcaacaaggacacgctgagaaagcggcactattggcgc
ctggactgcaagtgtatcacgctcttccagaacaacacgaccaacagatactataaggaa
attccgctgtcagaaatcctcacggtggagtccgcccagaacttcagccttgtgccgccg
ggcaccaacccacactgctttgagatcgtcactgccaatgccacctacttcgtgggcgag
atgcctggcgggactccgggtgggccaagtgggcagggggctgaggccgcccggggctgg
gagacagccatccgccaggccctgatgcccgtcatccttcaggacgcacccagcgcccca
ggccacgcgccccacagacaagcttctctgagcatctctgtgtccaacagtcagatccaa
gagaatgtggacattgccactgtctaccagatcttccctgacgaagtgctgggctcaggg
cagtttggagtggtctatggaggaaaacaccggaagacaggccgggacgtggcagttaag
gtcattgacaaactgcgcttccctaccaagcaggagagccagctccggaatgaagtggcc
attctgcagagcctgcggcatcccgggatcgtgaacctggagtgcatgttcgagacgcct
gagaaagtgtttgtggtgatggagaagctgcatggggacatgttggagatgatcctgtcc
agtgagaagggccggctgcctgagcgcctcaccaagttcctcatcacccagatcctggtg
gctttgagacaccttcacttcaagaacattgtccactgtgacttgaaaccagaaaacgtg
ttgctggcatcagcagacccatttcctcaggtgaagctgtgtgactttggctttgctcgc
atcatcggcgagaagtcgttccgccgctcagtggtgggcacgccggcctacctggcaccc
gaggtgctgctcaaccagggctacaaccgctcgctggacatgtggtcagtgggcgtgatc
atgtacgtcagcctcagcggcaccttccctttcaacgaggatgaggacatcaatgaccag
atccagaacgccgccttcatgtacccggccagcccctggagccacatctcagctggagcc
attgacctcatcaacaacctgctgcaggtgaagatgcgcaaacgctacagcgtggacaaa
tctctcagccacccctggttacaggagtaccagacgtggctggacctccgagagctggag
gggaagatgggagagcgatacatcacgcatgagagtgacgacgcgcgctgggagcagttt
gcagcagagcatccgctgcctgggtctgggctgcccacggacagggatctcggtggggcc
tgtccaccacaggaccacgacatgcaggggctggcggagcgcatcagtgttctctga

DBGET integrated database retrieval system