KEGG   Homo sapiens (human): 2587Help
Entry
2587              CDS       T01001                                 

Gene name
GALR1, GALNR, GALNR1
Definition
(RefSeq) galanin receptor 1
  KO
K04230  galanin receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2587 (GALR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2587 (GALR1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Neuropeptide
   Galanin [OT]
    2587 (GALR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srw 7tm_2 7TM_GPCR_Srv 7tm_4 7TM_GPCR_Srd Bac_rhodopsin Chitin_synth_1
Motif
Other DBs
NCBI-GeneID: 2587
NCBI-ProteinID: NP_001471
OMIM: 600377
HGNC: 4132
Ensembl: ENSG00000166573
Vega: OTTHUMG00000132875
Pharos: P47211(Tchem)
UniProt: P47211
Position
18q23
AA seq 349 aa AA seqDB search
MELAVGNLSEGNASWPEPPAPEPGPLFGIGVENFVTLVVFGLIFALGVLGNSLVITVLAR
SKPGKPRSTTNLFILNLSIADLAYLLFCIPFQATVYALPTWVLGAFICKFIHYFFTVSML
VSIFTLAAMSVDRYVAIVHSRRSSSLRVSRNALLGVGCIWALSIAMASPVAYHQGLFHPR
ASNQTFCWEQWPDPRHKKAYVVCTFVFGYLLPLLLICFCYAKVLNHLHKKLKNMSKKSEA
SKKKTAQTVLVVVVVFGISWLPHHIIHLWAEFGVFPLTPASFLFRITAHCLAYSNSSVNP
IIYAFLSENFRKAYKQVFKCHIRKDSHLSDTKESKSRIDTPPSTNCTHV
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggagctggcggtcgggaacctcagcgagggcaacgcgagctggccggagccccccgcc
ccggagcccgggccgctgttcggcatcggcgtggagaacttcgtcacgctggtggtgttc
ggcctgatcttcgcgctgggtgtgctgggcaacagcctagtgatcaccgtgctggcgcgc
agcaagccgggcaagccgcggagcaccaccaacctgttcatcctcaacctgagcatcgcc
gacctggcctacctgctcttctgcatccccttccaggccaccgtgtacgcgctgcccacc
tgggtgctgggcgccttcatctgcaagttcatccactacttcttcaccgtgtccatgctg
gtgagcatcttcaccctggccgcgatgtccgtggaccgctacgtggccatcgtgcactcg
cggcgctcctcctccctcagggtgtcccgcaacgcgctgctgggcgtgggctgcatctgg
gcgctgtccattgccatggcctcgcccgtggcctaccaccagggcctcttccacccgcgc
gccagcaaccagaccttctgctgggagcagtggcccgaccctcgccacaagaaggcctac
gtggtgtgcaccttcgtcttcggctacctgctgccgctcctgctcatctgcttctgctat
gccaaggtccttaatcacttgcataaaaagttgaagaacatgtcaaagaagtctgaagca
tccaagaaaaagactgcacagacagttctggtggtggttgtggtgtttggaatctcctgg
ctgccgcaccacatcatccatctctgggctgagtttggagttttcccgctgacgccggct
tccttcctcttcagaatcaccgcccactgcctggcgtacagcaattcctccgtgaatcct
atcatttatgcatttctctctgaaaatttcaggaaggcctataaacaagtgttcaagtgt
cacattcgcaaagattcacacctgagtgatactaaagaaagtaaaagtcgaatagacacc
ccaccatcaaccaattgtactcatgtgtga

DBGET integrated database retrieval system